KEGG   Arthrospira platensis: NIES39_E01630Help
Entry
NIES39_E01630     CDS       T02608                                 

Gene name
gdhA
Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
arp  Arthrospira platensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NIES39_E01630 (gdhA)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NIES39_E01630 (gdhA)
   00330 Arginine and proline metabolism
    NIES39_E01630 (gdhA)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NIES39_E01630 (gdhA)
Enzymes [BR:arp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     NIES39_E01630 (gdhA)
Exosome [BR:arp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NIES39_E01630 (gdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2548044..2549330
Genome map
AA seq 428 aa AA seqDB search
MVVSSQVTTTSPTPAYICPFDRTCSYLNQAAGELAMDPNILVILEHPRKVVTVSIPVKLD
NGKVQILAGHRVQHCDVLGPYKGGTRYHPTVNLGELSALAMLMTWKCALLGIPYGGAKGG
IAIDPAQYSLGELERLTRRYTSELIKDIGPAIDIPAPDIGTSSREMAWMMDTYSMNMGHA
VLGVVTGKPLSIGGSKGRDMATGRGVMITVREALLEKGQTLEGVTIAIQGFGKVGGAAAQ
LLHEAGANIIAVSDAFGGVFADHGLDIPALQSHVNNQKTVVGFPGSDSISNAELLTLPCD
VLIPAALEDQITEDNADRIQAKLVAEAANAPITLIADQILERRGITVLPDILANAGGVVV
SYLEWVQGQSFLFWDEKRVNREMEKLLRSAYHRVSQHSQQRSVSLRLAAYTLGVGRVAQA
IKDRGLYP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggttgtatcatcccaggtaacgaccacatccccaactccggcttatatttgtccattc
gatcgcacctgtagctatttaaaccaagcggctggggaactagccatggacccaaatatc
ttggtgattttagaacatccccggaaagtcgtcaccgtttccattccggttaaattagac
aatggaaaagtacaaatcctcgccggacaccgggtgcagcactgtgatgtcctcggtccc
tataaaggcggaacccgatatcatccaaccgttaatctgggagagttgtcagccttggcg
atgttgatgacctggaaatgtgccctattagggattccctacggcggcgctaaaggtggc
attgctattgacccggcacaatatagcctaggggaacttgaacgcctcacccgtcgctac
actagcgaattgattaaagatattggtccggcgatcgatatccctgcacccgatatcggc
acatcctcacgagaaatggcttggatgatggatacctattctatgaatatgggtcatgct
gtcttaggtgtcgtcaccggaaaacccctatctattggtggttcaaaaggtcgagatatg
gcgaccggacgcggggtgatgattactgtcagagaagccttattagaaaaaggacaaacc
ctagaaggtgtgacaattgctattcagggattcggaaaagttggcggcgcggcggcacag
cttcttcacgaagcaggggctaacattattgctgtttctgatgcctttggcggggttttt
gcggatcatggcttggatattccggctttgcaatctcatgtgaataaccagaaaactgtt
gtgggttttcctggtagcgatagcattagcaatgctgaattactcaccctcccctgtgat
gttctaattcctgctgctttggaagaccaaattactgaagataatgccgatcgcattcag
gctaaattagtggcagaggctgctaatgcgcccattactctcatagcagaccaaatactg
gaaaggcgggggattactgtcttaccagatatccttgctaatgctggtggtgtggtggtt
agctatcttgaatgggtacaaggtcagtctttccttttctgggatgaaaaacgggttaat
cgcgaaatggaaaaactactccgtagtgcttaccaccgcgttagccaacattcccaacag
cggtctgtctctttacgacttgctgcctatactctcggtgtcggtcgggtggcacaagct
attaaggataggggactctatccatag

DBGET integrated database retrieval system