KEGG   Arthrospira platensis: NIES39_E03590Help
Entry
NIES39_E03590     CDS       T02608                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
arp  Arthrospira platensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:arp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:arp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2778731..2780044)
Genome map
AA seq 437 aa AA seqDB search
MLRIITQWVEAQSELRRIGSRTHDDTIIHKEATVREVLQTVKRQGDKALLHYTQEFDHKT
LSLEQLRVSASELDVAYQQVNCELLDAIRLAKKQIEAFHRQRIPKSWVQFGDDNVVLGKR
YTPVDRAGLYVPGGQASYLSTVLMNAIPANVAKVPRIVMVTPPGIDNKISPAVLVAAQEA
GVQEIYRVGGAQAIAALAYGTETVPKVDVITGPGNIYVTLAKKLVYGTVGIDSLAGPSEV
LIIANSIASPVHVAADMLAQAEHDTMAAAILLTTDSALARQVVAEVERQLEHHPRRTMTE
KAIAHYGLVVVVDSLEAAAQLSNEFAPEHLELEVDEPWELLEHIRHAGAIFLGCSTPEAV
GDYLAGPNHTLPTSGAARYASALGVEVFMKHSSLIEYSPQALQKVANAVNILATAEGLPS
HADSVRLRTKNQGDGDF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattattactcagtgggttgaagcacaatcagaactgcgacgcatcggcagt
cgtacccatgatgatactattatccataaagaagctacggtgcgagaagtcctgcaaacc
gtgaagcggcaaggggataaagcactgctgcactacacccaagaatttgaccacaaaact
ctgagcctcgaacagttgcgggtcagtgcttcggagttggatgtcgcttatcaacaggtt
aattgtgaacttctcgatgcaattcggttagcgaaaaaacagattgaggcatttcaccgc
cagcgtattcctaagtcttgggttcagtttggcgatgataatgtggttttgggtaaacga
tacacccccgttgatcgggcgggtttatatgtgccgggtggccaagcctcctacctaagt
acagtgctaatgaatgccattccggctaatgtggctaaagtgcctcgcattgtcatggta
actccccccggtattgataataagattagtccggcggttttagtggcggctcaggaagct
ggagtccaggaaatttatcgagtaggcggggctcaggcgatcgctgctttggcttatggt
acggaaactgtgccgaaagttgatgtgataacaggtccgggtaatatatatgtaacgctg
gcgaaaaaattggtttatggtactgtcggtattgactccctcgctggaccgtctgaggtg
ctaattattgccaatagtatcgcctcgccggttcatgtggcggcggatatgctggctcag
gcagaacatgatacaatggcggcggcgattttgttgactacagactcagctttggctcgt
caggtggtggctgaggtggaacgacagcttgagcatcacccgcgccgaactatgacggaa
aaggcgatcgctcactatggtttagtggtggtggtggactccctcgaagccgcagctcag
ttatctaatgaatttgctcccgaacacctagaactagaagttgacgaaccctgggaacta
ttagaacacattcgccatgccggggcaattttcctaggttgttcgaccccggaagcggtg
ggagattatttagccggtcctaaccacaccctacccacttcaggggcggctcgctatgct
tccgctttaggagtcgaagtatttatgaaacactctagtttgattgaatattctccgcag
gcgctgcaaaaagtggcaaatgctgttaatattttggctactgcagaagggctaccatcc
catgcagattctgttcgtctacggacgaaaaatcagggagatggggatttttag

DBGET integrated database retrieval system