KEGG   Arthrospira platensis: NIES39_J00300Help
Entry
NIES39_J00300     CDS       T02608                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
arp  Arthrospira platensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NIES39_J00300
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NIES39_J00300
Enzymes [BR:arp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     NIES39_J00300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3286480..3288879)
Genome map
AA seq 799 aa AA seqDB search
MQYPSPTLNIPPYTWNRPIGLGWEKPYTVRYPSNLDDGPFHGMPLGGFGAGCIGRSHRGD
FNLWHLDGGEHIFRPLPGCQFSVFEEIDGKRQAYALSTQPPEDGSLSTWNWYPSSDQHTQ
TGTYHALYPRSWFVYENVFQTQLTCEQFSPVWGGNYQETSYPVAVFEWIAHNPTDKLIIL
SILLTWENTIGWFTNRLDTPAVKVRDDGSPVYEYQPRWGDSQDNCNHFVEDFHRVGCVMT
RLNINDQLGEGDGQMAIATITNPVVEVYCHNRWRPSGNGYDIWEYFSQDGSLIDIHDDGP
ALEGERIGAALAVRCILRPGKTRKIPFFIAWDLPVTEFEAGVTYYRHYTDFFGRNGRNAW
SMIRTAMKHSDTWRENIEAWQNPILNRQDLPPWFKMALFNELYLLTDGGSLWTAIDEDEP
WGRFAVLECLDYRWYESLDVRLYGSFGLLMWWPELEKSVMRAFAKAIATDDDTPRIIGYN
QASAIRKAAGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLPCDFVLQVYRDYLLTGADD
IQFLVECWPAIVQTLDYLKTFDRDRDCIPENGGAPDQTFDDWRMMGISAYCGGLWLAALE
AAIAIANILLSHHSDITPDTTKAIATWTNWLETAKPLYDQTLWNGSYYNLDSQSGSDVVM
ADQLCGQFYAALLGLPDIVPHHRARVALQTIYQACFQNFHNGKFGAANGVRTTGEPINPQ
DTHPLEVWTGINFGLGAFLIQMGMKEEAFQLAEAVITQVYQNGLQFRTPEAITAAGTFRA
SHYLRAMAIWAMYYQIQHP
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatccatccccaaccctaaatattcccccctatacttggaaccgtcccataggc
ttaggatgggaaaaaccctatacagtacgctaccctagtaatttagatgatggtcccttt
catggaatgcctttagggggttttggcgctggttgcattggtcggtctcatcggggagac
tttaatctatggcatcttgatggtggggaacatatctttcgcccccttcctggctgtcaa
tttagcgtttttgaggaaatcgacggtaaacgacaagcctacgccctatctacccaacct
cccgaagatggtagcttatcaacatggaattggtatcctagttccgatcagcatacccaa
accggaacctatcacgccctttacccccgcagttggtttgtttatgaaaatgtctttcaa
actcaattaacctgtgaacagttttccccggtgtggggcggaaattaccaggaaaccagt
tatcctgtggcggtgtttgagtggatagcccacaaccccaccgataaactaattatcctc
agtattttattaacctgggaaaataccatcggctggtttactaatcgtttagacactccc
gccgtgaaagtgcgcgatgatggtagtcccgtttacgaatatcagccgcgctggggagat
agccaggataattgtaatcactttgtggaagacttccaccgtgttggttgtgtgatgact
cgcttgaatattaatgaccaactcggagaaggggacggtcaaatggcgatcgccactatt
actaaccctgtcgttgaggtatattgtcacaaccgttggaggccctccggtaatggttac
gatatttgggaatatttttctcaggatgggtccctgattgatatacacgatgacgggccc
gcccttgaaggtgaaagaattggcgcggctttggccgtccgttgtatcctcagacccgga
aaaactcgcaaaattcccttttttatcgcctgggatttacctgtgactgagtttgaggcg
ggagttacttactaccgccactataccgatttttttgggcgcaatggtcgtaacgcttgg
tcaatgattcggacagctatgaagcattccgatacctggcgcgagaatatcgaagcatgg
caaaatccaattctcaatcgccaagatttacccccttggttcaaaatggctttgtttaat
gaactttatctactgacggacggggggagtctatggactgctattgatgaggatgagcct
tggggacggtttgctgtccttgaatgcttggattatcggtggtatgaaagtctcgatgtg
cgcctatatgggtcctttggtttgttgatgtggtggccagaattggaaaaatccgtgatg
cgggcttttgctaaggcgatcgctactgatgatgatacccccagaattattggttacaat
caagcctcagctattcggaaagctgctggggcgactccccatgacttgggggctcctaat
gaacatccttgggaaaagactaactacaccagttatcaggattgcaatttgtggaaagat
ttaccctgtgattttgtcttgcaggtatatcgcgattatctgctaacaggggccgatgat
attcagtttttggtagaatgttggccggcgatcgtccaaactctcgattatctcaaaacc
ttcgatcgcgatcgtgattgtatcccagaaaatggcggcgcaccagatcagacttttgat
gattggcgaatgatggggattagcgcctattgtgggggcttatggttagccgcattggaa
gccgctattgccatcgcaaatatcctactttcccatcatagtgatatcaccccagataca
actaaggcgatcgctacctggactaattggttagagaccgctaaacctctttatgaccaa
actctctggaatggtagctactacaatcttgacagtcagagtggatctgatgtcgtcatg
gccgatcaactttgtggtcagttttatgccgccttattaggtttgcccgatattgtcccc
caccatcgcgcacgagtggcgctacaaaccatttatcaagcctgcttccagaattttcat
aatggcaagtttggagccgctaacggtgtcagaactaccggagaacccattaatcctcaa
gatacccaccccctagaggtatggaccggcattaatttcggtctaggtgctttccttatt
caaatggggatgaaagaagaggcttttcaactcgccgaagccgttatcactcaagtatat
caaaacggcctccagttccgcaccccagaagctattaccgccgccggaactttccgcgct
agtcactatctccgcgctatggcaatttgggctatgtattatcaaatacaacacccctag

  All links  
No link information was found.   
DBGET integrated database retrieval system