KEGG   Arthrospira platensis: NIES39_J05830Help
Entry
NIES39_J05830     CDS       T02608                                 

Gene name
cobA_hemD
Definition
(GenBank) bifunctional uroporphyrinogen-III C-methyltransferase/uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
arp  Arthrospira platensis
Pathway
arp00860  Porphyrin and chlorophyll metabolism
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NIES39_J05830 (cobA_hemD)
Enzymes [BR:arp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     NIES39_J05830 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NIES39_J05830 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: BAI91629
UniProt: D4ZV14
Position
3845958..3847493
Genome map
AA seq 511 aa AA seqDB search
MTKLTGKVYLVGAGLGNVAYLTVKAYQLVKQAEVLVYDALVDQSIIPLISPHCLKVYVGK
RGSQVSTPQSEINGLLVKYCQQGKLVVRLKGGDPFIFGRASAEIQALIAAKCEFEVVPGI
SSALAAPLLAGIPVTDTVMSRCFAVMTAHEPEALNWASLSELETLVILMAARNLPVIVHQ
LRQHGRSPETPIAIIKNGGRFNQKVIVGTLNDIVDKTSRESLSPSVIVVGNVVQLQTYLQ
PRHNHSRIMLSPLLNHTILVTRSSEQSNEFRSLLEQKGAEVLEMPTLMIRPPSTWEPLDQ
AIAFSDTSKPFDWLLLTSANAVSFFFERLLANGKDTRILASTKIAVVGKKTAMVLRQWGL
NPDFIPPDFIADSLVENFPESVSGKRLLFPRVETGGREILVKELTQAGAEVVEVPAYESA
CPDTIDPNVQSALENGIISIATFTSSKTVKNFCKLLEGFAGDSWRDLVTGVAIASIGPQT
SQTCQTLLGRVDIEAQEYTLEGLTQAIIDKM
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaaccggaaaagtttatttagtaggggcaggattaggaaatgtagcttat
ttgactgtaaaagcctatcaattagtcaagcaggctgaagtcctagtttatgatgcccta
gttgatcagtcaattatacccctaatttcgccccattgtctgaaagtatatgtgggaaag
cgaggtagccaagtcagtacgccccaaagcgaaattaatggtttattagtaaaatattgt
caacaaggaaaactggtggtgcgactaaagggtggcgatccatttatctttggtcgcgct
agtgcggaaattcaagccttaattgctgctaagtgtgaatttgaggtagtcccaggtatt
tcctcagcattagccgcccccctactggctggtattcctgtcactgatacagtcatgagt
cggtgttttgcagtcatgacagcccatgagccagaagcgctaaattgggcgagtttatcg
gaactcgaaactttagttattctcatggcggcgcgaaatttacctgtgattgtacaccaa
cttagacaacatgggcgatcgcctgaaactcccatagcgattattaaaaatggcggtcgc
tttaatcaaaaggtaatcgttggcaccttaaatgatattgtagataaaacatcacgagaa
tccttatctcccagtgtcatagttgtggggaatgtcgtgcaactgcaaacctatctacag
cctcgccataaccactcaagaattatgctgagtccattacttaatcacaccattttagtc
acccgttcgtcggaacaatcaaacgagtttcgcagtttgctggaacaaaaaggggctgaa
gtcctagaaatgcctaccctaatgatcagacctccttctacttgggaaccccttgatcaa
gcgatcgccttctctgatacatcaaagccttttgactggctattattaacctctgctaat
gctgtatcattcttttttgaaagactcttggctaatggtaaagatacccgcattttagcc
agcactaaaattgctgtggtcggcaaaaaaaccgctatggttttgcgacaatggggacta
aatcctgattttatacccccggactttatcgctgattccctagtcgaaaacttccccgaa
tcagttagcggaaaacgtctattatttcccagagtggaaaccggaggtcgggagatatta
gttaaggaattaacccaagctggtgcggaagtagtagaggttcccgcctatgagtccgct
tgtccagataccatcgatccgaatgttcaatcagccttagaaaatggtataattagtatt
gccacctttaccagttccaagactgtcaaaaatttctgtaaactcctagaaggctttgcg
ggtgattcctggcgagatttagtcaccggagtggcgatcgcctctattggtccccagacc
tcccagacctgccaaactctcctaggaagggttgatattgaagcccaagaatatacccta
gaaggactcactcaggctatcatagataaaatgtag

DBGET integrated database retrieval system