KEGG   Arthrospira platensis: NIES39_K04110Help
Entry
NIES39_K04110     CDS       T02608                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
arp  Arthrospira platensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NIES39_K04110 (malQ)
Enzymes [BR:arp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NIES39_K04110 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4292265..4293776)
Genome map
AA seq 503 aa AA seqDB search
MHLERASGILLHPTSFPSRFGIGDLGRAAYEFIDFLERSGQKIWQILPLGPTGYEHSPYI
MNFSTFAGNPLLISLDRLAEEGLLNSRELLPLPDNHNPQRVDFPRVIPHKGQYLKQAFDS
FWESLQSQPNHRFEEFCQQKASWLNDYALFMALLEQNDGKDWNQWEPAIARREPQALQAK
TEELHVQIIYHKFLQFKFFEQWSQLRRYANNKGIKIIGDISIYVCYNSADVWFAPNNFQL
HPETLNPAYIAGVPPDYFSATGQLWGNPVYDWDELKRTNYAWWIERFRATLEYVDLVRVD
HFRGFEAYWRVPYGETSALNGEWVTAPGAEFFESLGQQLGSLPVLAEDLGIITPEVEELR
DRFEFPGMKILMFAFGEDSNHPYLPHNYTRNSIVYTGTHDNDTTVGWWQTMTPEIRQHVA
GYLGYAFPEAIEDINWALIRLALSSIADLAIFPFQDLLGLDNRGRMNDPSTNAGNWRWRY
ESSTLLTHPLCDRLRYLTQMYSR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttgaacgagccagcggtatcttattacaccccaccagcttccctagtcgcttt
ggtattggtgacttaggacgtgccgcttatgagtttatcgatttcctagaacgtagtggc
cagaaaatttggcaaattctgcctctcggtccgacaggttacgagcattccccctacatt
atgaactttagcactttcgcgggaaatcctctgttgatttctctcgatcgcctagccgaa
gaagggttactcaatagccgggaattgctacccttaccagataaccataatcctcagcgc
gttgactttcctagggtaattcctcataaaggacaatacctcaaacaagcctttgattcc
ttctgggagtccctacaatcacaacctaaccatcgtttcgaggagttttgtcaacaaaaa
gcctcctggctcaatgattacgccctatttatggcactcctagagcagaacgacggtaaa
gattggaatcagtgggaaccggcgatcgcccgccgagagccccaagccttgcaagccaaa
accgaagaactccatgttcagattatataccataagtttctgcaattcaagttttttgaa
caatggagccaactgcgacgctacgccaacaataaaggcattaaaattattggtgatatc
tccatttatgtatgctataacagtgctgatgtctggtttgcgcctaacaactttcaactg
cacccagaaacccttaatcctgcctatattgccggagtaccccccgactattttagtgcc
accggacaactttgggggaatcccgtttatgattgggatgaattaaaacgcactaattat
gcttggtggattgaaagattccgcgctaccttggaatatgtagatttagtccgggttgac
catttccgaggctttgaagcctattggcgagttccctatggggaaacttccgctttgaat
ggggagtgggtaacagcgcccggtgcggagttctttgagagtctcggtcaacagttagga
agtttaccggttttagcggaagatttaggaatcattaccccagaggtggaagagttacgc
gatcgctttgagtttcccggaatgaaaatcctcatgtttgcatttggggaagattctaac
catccttatttaccccataattatacccgcaatagcattgtttacaccggaacccatgac
aatgataccactgtcggttggtggcaaaccatgaccccagaaattcgtcagcacgtagct
ggatatttaggttatgctttcccagaagccattgaggacattaattgggctttaattcgg
ttagccctaagttccattgctgacctagccattttcccgtttcaagacctgctaggatta
gataatagggggagaatgaatgaccctagcaccaatgccggaaattggcggtggcgctat
gaaagttccacattgttaacccatcctttgtgcgatcgcctgcgctatttaacccaaatg
tatagccgctaa

DBGET integrated database retrieval system