KEGG   Arthrospira platensis: NIES39_L00830Help
Entry
NIES39_L00830     CDS       T02608                                 

Definition
(GenBank) alcohol dehydrogenase/acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
arp  Arthrospira platensis
Pathway
arp00010  Glycolysis / Gluconeogenesis
arp00071  Fatty acid degradation
arp00350  Tyrosine metabolism
arp00620  Pyruvate metabolism
arp00625  Chloroalkane and chloroalkene degradation
arp00626  Naphthalene degradation
arp00650  Butanoate metabolism
arp01100  Metabolic pathways
arp01110  Biosynthesis of secondary metabolites
arp01120  Microbial metabolism in diverse environments
arp01130  Biosynthesis of antibiotics
arp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES39_L00830
   00620 Pyruvate metabolism
    NIES39_L00830
   00650 Butanoate metabolism
    NIES39_L00830
  Lipid metabolism
   00071 Fatty acid degradation
    NIES39_L00830
  Amino acid metabolism
   00350 Tyrosine metabolism
    NIES39_L00830
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NIES39_L00830
   00626 Naphthalene degradation
    NIES39_L00830
Enzymes [BR:arp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NIES39_L00830
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NIES39_L00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 YozE_SAM_like
Motif
Other DBs
NCBI-ProteinID: BAI92244
UniProt: D4ZXG9
Position
complement(4505897..4508668)
Genome map
AA seq 923 aa AA seqDB search
MRISQETHLNDLIQQVKDAQAQYATYSQKQVDKIFQVAALAANASRINLAQMAVEETGMG
VVEDKVIKNHFASEYIYNKYKGEKTCDVIESDPHYGWQKIAEPLGIVAGIIPTTNPTSTA
IFKALLALKTRNGIIFSPHPRATECTIKAAKIILDAAVAAGAPKGIIGWIDNPTLQWSQE
LMQHPDISLILATGGPGMVQAAYSSGHPSMGVGSGNTPAIIDATADLKMAVSSILISKTF
DNGMICASEQAVIVQDEVYTSVKQELIARGGYFLKQQEKEAIRQLILKDGRLNPEIVGQS
VQKLAEMAGIQVQENTKVLIGEVTKVGVNEPLSYEKLSPILAMYRASSFPAAVETAQKLI
IFGGKGHTSVLYTHPGNSEHIKYFESRLQTGRVLINTPSSQGAIGDVYNFRLSPSLTLGC
GSWGGNSISENVEPHHLLNIKNVAQRRENMLWFRVPPKIYFKGGCLPVALGELQGKKRAF
IVTDKPLFDMGLVTQVTEVLDRIGVPHYVFYDVEPDPKLSNINKGVELMNSYQPDIIIAF
GGGSPMDAAKIMWLMYEHPEIEFDGLATRFMDIRKRVYALPELGNKAIMVAIPTTSGTGS
EVTPFAVVTDDRTGIKYPLADYALTPNMAIVDPELTLNMPKKLTAYGGIDAVTHALEAYV
SICGSQFTNGLALEALGLLFKYLPSAYQNGAKDPKAREQVHYAATIAGMAFANAFLGICH
SLAHKLGSTFHLPHGLANALMISHVIRYNSTDAPFKQAIFPQYEYPQAKQRYAEISDYLK
LGGNTLDEKVEKLIEAVEYLKQQIEIPPTIKQSLDIEEKEFMSNLPNLANQAFDDQCTAA
NPRYPLIGDLQNLYATAYHEPAVKKAPIHPECQPEESRKTQQAEYLNMIEKYCQGGESAM
AVGDLDKDTLIGLNDAWWKTGVM
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgagaattagccaagaaactcacctaaatgatttaatccaacaagtcaaagatgctcaa
gcccaatacgccacttacagccaaaaacaggtagacaaaattttccaagtcgctgcttta
gccgccaacgcatcccggattaatttggctcaaatggccgtagaagaaacgggaatggga
gtagtagaagacaaggtaatcaaaaatcactttgcttctgaatacatttacaacaaatac
aaaggcgaaaaaacctgtgatgttatcgaatctgacccccattatggctggcaaaaaatc
gctgaacccctaggaattgtggcgggaattatcccgacaactaatccgacatctacggct
atttttaaagccttattagccctcaaaacccgcaatggtattatcttttctcctcacccc
agagccacagaatgcacgattaaagctgccaaaattatcctagatgctgcggtagctgct
ggcgcaccaaagggaattattggatggatagataacccaactctccaatggtctcaagag
ttgatgcagcatcctgatatcagcctaattttagcaacaggcggaccgggaatggtgcag
gctgcttattcatctggacatcctagcatgggggtgggttctgggaatactccggcgatt
attgatgcaactgcagacctaaaaatggctgtttcttctatcttaattagcaaaactttt
gacaatggtatgatttgcgcttctgaacaagcagtaattgttcaagatgaggtgtatacc
agtgttaagcaggagttgatagctaggggcggttattttctgaaacagcaggaaaaagaa
gccatccgacaactgattctcaaagatgggcgattaaatccagaaattgtgggtcagtcg
gtgcaaaaattggcagaaatggcaggtattcaagtacaagaaaatactaaagttctgata
ggggaggtgacgaaagttggggttaatgaacctctatcttatgaaaagctatcgccaatt
ttggcaatgtatcgggctagtagtttccccgcagcagttgagaccgcccaaaagttaatt
atttttggtggtaaaggacatacatctgttttgtatactcatcctgggaatagcgaacat
atcaaatattttgaaagtcgcttgcaaactgggcgggtcttaattaatactccttcttct
cagggggctattggcgacgtttacaatttccgactgtctccttctctgactttaggatgc
ggtagttgggggggtaattcgattagcgaaaatgtggaacctcaccatttattaaacatt
aaaaatgtcgcgcaacgtcgggaaaatatgttgtggttccgagtgccgcccaagatttac
tttaaggggggatgtttaccagtagccctgggagagttacagggtaaaaaacgggctttt
attgtgacggataaacctctgtttgatatgggattagttacgcaagttacggaggtgtta
gaccggataggagtaccccattatgtgttctatgatgtggaaccagacccgaaactttct
aatattaataaaggggtggaacttatgaatagttatcagcccgatattatcatcgctttt
ggtggcggttcccccatggatgcggctaaaattatgtggctgatgtacgaacatccggaa
attgagtttgacggtttggcgacgcgatttatggatattcggaagcgggtttatgcttta
ccagaactaggaaataaagctattatggtggcaattcctactacttctgggacgggttct
gaggtgacaccttttgctgtggttacggacgatcgcacggggattaaatatcctctggct
gattatgcgctgaccccaaatatggcgatcgttgatccggaattaaccttaaatatgccg
aagaaactaacggcttatggtggtattgatgcggtgactcacgccttagaagcctatgtc
tcaatttgtgggtcacagtttactaatggactggcattagaggcattagggttactgttt
aaatacttgccttctgcttatcaaaatggcgcaaaagacccgaaggcgcgtgaacaggtg
cattatgctgccactattgctggcatggcttttgcgaatgcttttttaggtatttgtcat
tccctagcacacaaattaggttcgactttccatttacctcacggcttggcaaatgcttta
atgatttcccatgtgattcggtataattctacggatgctccttttaaacaggcgattttt
ccgcagtatgaatacccccaagctaaacagcgttatgcagaaatatctgactacctaaaa
ttaggcggaaatacccttgatgagaaggtagaaaaattgatagaagctgtggaatacctc
aagcaacaaattgagattccaccgacgattaaacaatcactagacatcgaagaaaaggaa
tttatgagtaacttacctaatttggctaaccaggcttttgatgaccaatgtactgctgct
aacccccgttatccgttaattggtgatttgcagaatttgtacgctactgcttatcatgaa
ccggctgttaaaaaagcaccaattcacccagaatgtcagccagaagaaagccggaaaact
caacaagccgaatatctaaacatgattgaaaagtattgtcaaggtggtgagtcggctatg
gctgttggcgacctggataaggatacgttaatcgggttaaatgatgcttggtggaaaact
ggggttatgtaa

DBGET integrated database retrieval system