KEGG   Arthrospira platensis: NIES39_L00830Help
Entry
NIES39_L00830     CDS       T02608                                 

Definition
alcohol dehydrogenase/acetaldehyde dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
arp  Arthrospira platensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NIES39_L00830
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES39_L00830
   00620 Pyruvate metabolism
    NIES39_L00830
   00650 Butanoate metabolism
    NIES39_L00830
  Lipid metabolism
   00071 Fatty acid degradation
    NIES39_L00830
  Amino acid metabolism
   00350 Tyrosine metabolism
    NIES39_L00830
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NIES39_L00830
   00626 Naphthalene degradation
    NIES39_L00830
Enzymes [BR:arp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NIES39_L00830
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NIES39_L00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4505897..4508668)
Genome map
AA seq 923 aa AA seqDB search
MRISQETHLNDLIQQVKDAQAQYATYSQKQVDKIFQVAALAANASRINLAQMAVEETGMG
VVEDKVIKNHFASEYIYNKYKGEKTCDVIESDPHYGWQKIAEPLGIVAGIIPTTNPTSTA
IFKALLALKTRNGIIFSPHPRATECTIKAAKIILDAAVAAGAPKGIIGWIDNPTLQWSQE
LMQHPDISLILATGGPGMVQAAYSSGHPSMGVGSGNTPAIIDATADLKMAVSSILISKTF
DNGMICASEQAVIVQDEVYTSVKQELIARGGYFLKQQEKEAIRQLILKDGRLNPEIVGQS
VQKLAEMAGIQVQENTKVLIGEVTKVGVNEPLSYEKLSPILAMYRASSFPAAVETAQKLI
IFGGKGHTSVLYTHPGNSEHIKYFESRLQTGRVLINTPSSQGAIGDVYNFRLSPSLTLGC
GSWGGNSISENVEPHHLLNIKNVAQRRENMLWFRVPPKIYFKGGCLPVALGELQGKKRAF
IVTDKPLFDMGLVTQVTEVLDRIGVPHYVFYDVEPDPKLSNINKGVELMNSYQPDIIIAF
GGGSPMDAAKIMWLMYEHPEIEFDGLATRFMDIRKRVYALPELGNKAIMVAIPTTSGTGS
EVTPFAVVTDDRTGIKYPLADYALTPNMAIVDPELTLNMPKKLTAYGGIDAVTHALEAYV
SICGSQFTNGLALEALGLLFKYLPSAYQNGAKDPKAREQVHYAATIAGMAFANAFLGICH
SLAHKLGSTFHLPHGLANALMISHVIRYNSTDAPFKQAIFPQYEYPQAKQRYAEISDYLK
LGGNTLDEKVEKLIEAVEYLKQQIEIPPTIKQSLDIEEKEFMSNLPNLANQAFDDQCTAA
NPRYPLIGDLQNLYATAYHEPAVKKAPIHPECQPEESRKTQQAEYLNMIEKYCQGGESAM
AVGDLDKDTLIGLNDAWWKTGVM
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgagaattagccaagaaactcacctaaatgatttaatccaacaagtcaaagatgctcaa
gcccaatacgccacttacagccaaaaacaggtagacaaaattttccaagtcgctgcttta
gccgccaacgcatcccggattaatttggctcaaatggccgtagaagaaacgggaatggga
gtagtagaagacaaggtaatcaaaaatcactttgcttctgaatacatttacaacaaatac
aaaggcgaaaaaacctgtgatgttatcgaatctgacccccattatggctggcaaaaaatc
gctgaacccctaggaattgtggcgggaattatcccgacaactaatccgacatctacggct
atttttaaagccttattagccctcaaaacccgcaatggtattatcttttctcctcacccc
agagccacagaatgcacgattaaagctgccaaaattatcctagatgctgcggtagctgct
ggcgcaccaaagggaattattggatggatagataacccaactctccaatggtctcaagag
ttgatgcagcatcctgatatcagcctaattttagcaacaggcggaccgggaatggtgcag
gctgcttattcatctggacatcctagcatgggggtgggttctgggaatactccggcgatt
attgatgcaactgcagacctaaaaatggctgtttcttctatcttaattagcaaaactttt
gacaatggtatgatttgcgcttctgaacaagcagtaattgttcaagatgaggtgtatacc
agtgttaagcaggagttgatagctaggggcggttattttctgaaacagcaggaaaaagaa
gccatccgacaactgattctcaaagatgggcgattaaatccagaaattgtgggtcagtcg
gtgcaaaaattggcagaaatggcaggtattcaagtacaagaaaatactaaagttctgata
ggggaggtgacgaaagttggggttaatgaacctctatcttatgaaaagctatcgccaatt
ttggcaatgtatcgggctagtagtttccccgcagcagttgagaccgcccaaaagttaatt
atttttggtggtaaaggacatacatctgttttgtatactcatcctgggaatagcgaacat
atcaaatattttgaaagtcgcttgcaaactgggcgggtcttaattaatactccttcttct
cagggggctattggcgacgtttacaatttccgactgtctccttctctgactttaggatgc
ggtagttgggggggtaattcgattagcgaaaatgtggaacctcaccatttattaaacatt
aaaaatgtcgcgcaacgtcgggaaaatatgttgtggttccgagtgccgcccaagatttac
tttaaggggggatgtttaccagtagccctgggagagttacagggtaaaaaacgggctttt
attgtgacggataaacctctgtttgatatgggattagttacgcaagttacggaggtgtta
gaccggataggagtaccccattatgtgttctatgatgtggaaccagacccgaaactttct
aatattaataaaggggtggaacttatgaatagttatcagcccgatattatcatcgctttt
ggtggcggttcccccatggatgcggctaaaattatgtggctgatgtacgaacatccggaa
attgagtttgacggtttggcgacgcgatttatggatattcggaagcgggtttatgcttta
ccagaactaggaaataaagctattatggtggcaattcctactacttctgggacgggttct
gaggtgacaccttttgctgtggttacggacgatcgcacggggattaaatatcctctggct
gattatgcgctgaccccaaatatggcgatcgttgatccggaattaaccttaaatatgccg
aagaaactaacggcttatggtggtattgatgcggtgactcacgccttagaagcctatgtc
tcaatttgtgggtcacagtttactaatggactggcattagaggcattagggttactgttt
aaatacttgccttctgcttatcaaaatggcgcaaaagacccgaaggcgcgtgaacaggtg
cattatgctgccactattgctggcatggcttttgcgaatgcttttttaggtatttgtcat
tccctagcacacaaattaggttcgactttccatttacctcacggcttggcaaatgcttta
atgatttcccatgtgattcggtataattctacggatgctccttttaaacaggcgattttt
ccgcagtatgaatacccccaagctaaacagcgttatgcagaaatatctgactacctaaaa
ttaggcggaaatacccttgatgagaaggtagaaaaattgatagaagctgtggaatacctc
aagcaacaaattgagattccaccgacgattaaacaatcactagacatcgaagaaaaggaa
tttatgagtaacttacctaatttggctaaccaggcttttgatgaccaatgtactgctgct
aacccccgttatccgttaattggtgatttgcagaatttgtacgctactgcttatcatgaa
ccggctgttaaaaaagcaccaattcacccagaatgtcagccagaagaaagccggaaaact
caacaagccgaatatctaaacatgattgaaaagtattgtcaaggtggtgagtcggctatg
gctgttggcgacctggataaggatacgttaatcgggttaaatgatgcttggtggaaaact
ggggttatgtaa

DBGET integrated database retrieval system