KEGG   Arthrospira platensis: NIES39_O04000Help
Entry
NIES39_O04000     CDS       T02608                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
arp  Arthrospira platensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES39_O04000 (rbsK)
Enzymes [BR:arp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NIES39_O04000 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5934741..5935679)
Genome map
AA seq 312 aa AA seqDB search
MSILVFGSINMDLVVQTPRLPQPGETVTGYNFLSVAGGKGANQAVAAARLGAKTDIVGRV
GGDAFAEELLEELKGNRVGCKGVLRDNTTHSGLATIAVDNHGENQIIIIPGANGSVGHED
VQRLQPLWEEATSLLLQLEIPLKAVEAAIHAAHNAGVRVILDPAPAPDVFPQQLYPLVDI
ITPNETEASQLVGFPVNNVETAQKAADTLLSFGVKTAVIKLGSKGVFWATKSESFLVPAF
AVNAVDTVAAGDAFNGGMAAALDEGRSLKEAILWGAATGALSTTQVGAQSSLPDRQALDN
VLMPPMSTLTIN
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttagttttcggcagcatcaatatggatctagtggtgcaaactcctcgactc
cctcaacctggggagactgtgaccggatataattttttatcggtagcgggtggaaaggga
gcaaatcaagcggtagcagcagcacggttaggggcaaaaactgatatagtaggaagggtt
ggcggggatgcttttgctgaggaacttttggaagaattaaaaggtaatcgtgtaggttgt
aaaggggttttacgcgataatactacccattctggtttggcgactattgcagtggataat
cacggcgaaaatcaaattattattattcctggtgctaatggttctgtgggccatgaagat
gtgcagagactacaacctttatgggaggaagcaacatctttattattgcaattagaaatc
ccgctaaaagcagtggaagcggctattcatgctgcccacaatgcgggagtgagagtaatt
cttgatcctgcacccgcccctgatgtttttcctcaacaattatatcccttggtggatatt
attacgcccaacgaaactgaggcgagtcaacttgtaggctttccggtgaacaatgtagaa
actgcccaaaaagctgcggatactctcttgagttttggggtaaaaactgctgtgattaaa
ttgggttctaagggtgtgttttgggcgactaaatctgaatcttttttggttccggctttt
gcggttaatgcggtggatactgtggcggcgggagatgcttttaatgggggaatggcggcg
gctttggacgaggggcgatcgctaaaggaggcgattctctggggggcggcaacgggggct
ttatccacgactcaggtaggggcgcagtcttctctacccgatcgccaagccttagataat
gtattgatgccgcctatgtcaactttgacgattaattga

DBGET integrated database retrieval system