KEGG   Arthrospira platensis: NIES39_O05070Help
Entry
NIES39_O05070     CDS       T02608                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
arp  Arthrospira platensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NIES39_O05070
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NIES39_O05070
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NIES39_O05070
Enzymes [BR:arp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NIES39_O05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6043648..6045819)
Genome map
AA seq 723 aa AA seqDB search
MLNAEDFYSESFYLANNPDVAQAVDLGVISSGFEHFIESGQFQVRQPTPLYDELYYLTTN
PDVAALVNVGAIASGFQHFINFGQRERRNPSILFNTDFYIDEYPFIQAAIEAGDITAIEH
FVKAGQFEDFRPSVLYNPNYYLARNPDVAARVERDELTGIEHYLDIGAAQNRDFSAFLEV
NGSSFPNRVASGDTRENSTILMARNTVVGPITFETATDPNFNNVVSSLTTNNSDPTVPVK
VFVSDLTPGTPYFYRVTNAMGESDRGIFRTPLSLGSQGGLRFGAAGDSQGELMPHVAVRN
APERGLDFFVQLGNTISASTESPDLPGVSQAETLLDFHTKHNEIYRERLTLNPWGNLRVA
TSMLGVWNDGEIIDNFAGGSLGADGEGDWLNNSEIFETALAGFLDYQPRRQESYGDISDR
RTANREQLSRVTTYGDDAAAFWLDVRSFRDAPLEQVAETSFPEDIDAFLRDSFDANRTML
GRTQLQQLQLNLLGAQAAGLTWKFIFSPVPMQNLGIPGASDRWEGYAAERTRLLKFIDDN
NIDNVVFVSAGVGGTVVNNLTFAEEFGGPQIPVDAMEITVGPVGVQTDLGSGLVGATLGP
VAVNGATEWQLTRQGKATYEGLQTRWERDRLVENLLNTRLEDMGYNPIGLEGSGIDAQEI
VPGSYLAAHTFGWTEFVIDPNTQQLRVTTYGVEPYTQVDVERVPARVINRQPQVVSDFVV
NPQ
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacgctgaagatttttacagcgaatcgttttatctagccaataaccctgacgta
gcgcaagcagttgatttgggagttattagtagtggctttgaacattttatcgagtcaggt
cagtttcaggttagacaaccgacaccgctttatgatgaattatattatttgacgactaat
cctgatgtggcggcgttggtcaatgtaggtgcgatcgccagtggttttcaacattttatt
aatttcggtcagcgggaaagacgcaatcccagcattctatttaatacggatttttatata
gatgaatacccctttattcaagcagccatagaagccggagatatcacagcgatcgagcat
tttgtcaaagccggtcaatttgaggattttcgccctagtgtattgtataaccctaattat
tatttagcccgaaatcctgatgtggcggcgagggtagaacgtgatgaactgaccggtatc
gagcattatttggatattggagcggctcaaaatcgtgattttagtgcttttctggaggtg
aatggttccagttttccgaaccgtgtcgctagtggagatactagggaaaatagcacaatt
ttaatggcgcgtaatactgtggtgggtcccattacttttgaaacagccaccgatccgaat
tttaataatgtggtttcctcgttgactactaataattctgatccgacggttccggttaag
gtatttgtgtccgatttaacgccggggacaccttatttttatcgggttactaatgctatg
ggggaaagcgatcgcggtatttttcgcactcctttatctttgggaagtcaaggcggatta
aggtttggtgctgctggtgattctcagggggaattaatgcctcatgtcgccgtcagaaat
gccccagaacgtggtctagatttttttgtacagttaggaaatacaatttctgccagtacc
gagtctcctgatttaccaggtgtttctcaggcggaaactttgttagatttccacaccaaa
cataatgagatttatcgggaacgtctgactttgaatccttggggaaatttgcgagtcgca
acttctatgctaggggtgtggaatgatggggaaatcatcgataattttgccggtggtagt
ctgggggcagatggtgagggtgattggttgaataacagcgagatttttgagaccgcgttg
gcgggttttttagattatcaacctcggcgacaggaaagttatggagacattagcgatcgc
cgtaccgctaaccgagaacaactgtctcgcgttactacctatggagatgatgcagccgcg
ttttggttggatgtgcgatcgttccgggatgcacccttagaacaggtcgcagaaacctct
tttcccgaagatattgacgcatttttgcgggattcttttgatgctaatcgaaccatgttg
ggacgaactcagttgcaacagttgcagttaaatttactaggcgcacaggctgccggttta
acttggaagtttatattttctccggttcctatgcaaaatttggggattccgggtgccagc
gatcgctgggaaggatacgccgctgaacgcactagactcctgaaatttattgatgataat
aatattgataatgtcgtgtttgtgtccgccggagttggcggaactgtagttaataatttg
acatttgctgaggagtttggcgggccgcaaattcccgtagatgctatggaaattaccgta
ggtccggtgggcgtacagaccgatttaggatcgggtctagtgggggctactttgggtccg
gtggctgttaatggggccactgaatggcaactaacccgacaaggaaaggcgacttatgag
gggttacagacccgctgggaacgcgatcgcctggtggagaatctcctaaatactcgcctt
gaagatatgggttataatcctattggtttggagggttcgggaattgatgcacaggaaata
gttccgggttcctatttggccgctcatacttttggctggaccgagttcgtcattgatccc
aatactcaacaacttagggtgaccacctatggggtcgaaccttatacacaggtcgatgtc
gaaagggttcccgcccgggtaattaatcgtcaaccccaagtggtcagcgactttgtggta
aatcctcaataa

DBGET integrated database retrieval system