KEGG   Arthrospira platensis: NIES39_R00680Help
Entry
NIES39_R00680     CDS       T02608                                 

Gene name
hemG
Definition
protoporphyrinogen IX oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
arp  Arthrospira platensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:arp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6677556..6679007)
Genome map
AA seq 483 aa AA seqDB search
MTNLVDSLIVGAGISGLSLAHSLNREKNPRSPLKVLVTESQNRVGGNITTGRASDFLWEE
GPNSFAPTPELLGLAVDLGLKQELIFADRKLPRYVYWNHKLHPVPMTPPALLSSQLISPR
GKLRAALGAIGFVPPPVGAHLSQQRGEETITQFFHRHLGSEVLERLVQPFVSGVYAGDPQ
QLAVRSAFSRLVAAEDAGGALLPGFVRSRLNKKTTKDTTPDPNIPKTRPGELGSFRYGLE
TLPETLASKLGDRVKLNWTLDRFYPTPHQTYIAEFSTPDGPQQVETRTLALMTPAHVSAR
LLQPLHSQIASALSQIPYPPVACVVLAYPKSALKQQLKGFGNLIPRHQGIRTLGTIWTSS
LFPGRAPESWQVLSNYIGGATDPEIGEMDDDQIVAAVHQDLRQILLAEDVPPKVLAVHLW
RRAIPQYTLGHQDRLNSINAGLRSLPGLYLCSNYIDGVSVGDCVRRGQQWASQIQSHLHP
TAN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacctagttgatagccttatagttggtgctggtattagcgggctaagtttagcc
catagcctgaaccgtgaaaaaaacccccgctcacccctaaaagttttggtcacagaaagc
cagaaccgagtcgggggaaatattacgaccggacgcgcatctgattttttatgggaagaa
ggccctaacagttttgcccccacccctgaattactcggactagccgtagatttggggctt
aaacaagaattgatttttgccgatcgcaaactaccccgttatgtctactggaaccataag
ttacatccagtacccatgaccccccccgccctactctcctcccaactaatcagccccaga
ggtaaactccgcgccgccttgggagccataggatttgtgccacccccagtaggcgctcac
ctctctcaacagcgaggagaagaaactattacccagtttttccatcgacatctcggttca
gaagtcctagaacgtctcgtccagcccttcgtttctggggtttatgctggcgaccctcaa
caattagcagtccgttccgcttttagtcgattagtagccgccgaagacgcagggggtgcg
ctactacctggatttgtgcgatcgcgccttaataaaaaaaccaccaaagacaccaccccc
gaccccaatattcccaaaactcgccccggtgaattagggtcctttcgttatggcctggaa
actctgcccgaaaccttggccagtaaattaggcgatcgagttaagttaaattggaccctc
gaccgtttttatcccacccctcatcaaacctatattgctgaattttccaccccagacggc
ccccagcaagtagaaacccgaaccctcgctttaatgacccccgcccatgttagcgctcgc
ctcttgcaacccctacactctcaaatcgcttccgcattaagccaaattccttatcccccc
gtcgcttgtgtcgtactcgcctatcctaaatcagccttaaaacaacaactcaaaggcttt
ggtaatttaattccccgccatcaaggaatccgtaccctcggcactatttggacctccagt
ttattccccggtcgcgccccagaatcttggcaagtcctcagcaattatattgggggtgct
acagaccctgaaattggcgaaatggatgatgatcaaattgtcgccgccgttcatcaagac
ctacgccaaattctgctggctgaagatgtcccccccaaagtcttggctgtccatctctgg
cggcgcgctatcccacaatatactctcggtcatcaagatcgcctaaattccatcaatgct
ggattgcgatcgcttcccggactttatctgtgtagcaactatattgatggggtttccgtc
ggtgactgtgtgaggcgcggccagcaatgggcatcgcaaattcagtcccaccttcatcca
acagccaactaa

DBGET integrated database retrieval system