KEGG   Arthrobacter sp. Rue61a: ARUE_c01370Help
Entry
ARUE_c01370       CDS       T02215                                 

Gene name
folP
Definition
dihydropteroate synthase FolP (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARUE_c01370 (folP)
Enzymes [BR:arr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     ARUE_c01370 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142179..143084
Genome map
AA seq 301 aa AA seqDB search
MDSLAAAPGTGPATSPLSILRKPRPAARFEDLPTDRTLVMGILNVTPDSFSDGGTHRTPD
TAIALGLRMFYAGADIIDVGGESTRSGAEPVSPEEEQRRVLPVIQALVKAGALVSIDTMH
TSTAAAAIEAGAAIINDVSGLTIEPDMPELVARTKVPYILTHRRGDALTMDSLTDYNNVT
EDVVAEISGVRDKLYAAGVAPEQIIIDPGVGFSKNEDQNWEILKNLDQLFSLGHKVMVAA
SRKRFLGSLLTVAGKSAAPLERDAATAAITALSATKGAWAVRVHDVGPSLDAVKVAARIS
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggactccctcgctgcagcacccggaaccggcccggccacaagcccgttgtcgattctc
cgcaaaccgcgccccgcggccaggttcgaggacctgccaacggaccgcacgctcgtcatg
ggaatcctcaatgtcaccccggattccttcagcgacggtggcacgcaccggacaccggac
accgccatcgcgctcggcctgcgcatgttttacgcaggcgcagacatcatcgacgtcggg
ggtgagtccactcgctccggcgctgaaccggtttcccctgaggaagaacagcgccgcgtc
ctccccgtgatccaggcactggtgaaggcaggagcgctggtcagcattgacacaatgcac
acgtccacggctgccgctgccatcgaggcaggcgctgccatcatcaacgatgtttccggc
ctgacgattgaaccggacatgccagagctcgttgcccggaccaaggttccgtacatcctg
actcatcgccgcggcgacgccctgaccatggacagcctcacggactacaacaacgtcacg
gaggacgtggtggctgagatcagcggcgtccgcgacaagctttacgcagctggcgttgcg
ccggagcagatcatcatcgatcccggcgtcggtttctccaagaacgaggaccagaactgg
gagatcctcaagaacctggaccagcttttctcgctgggccacaaggtgatggttgcggct
tcccgcaaacggttcctcggttcgcttctcacggtggcaggtaagtccgctgcgcctctg
gaacgcgatgctgccaccgctgccattaccgctttgagcgccactaagggcgcttgggct
gtccgcgttcacgacgtcggccccagccttgacgccgtcaaggtcgccgcccgcatttcc
cgctga

DBGET integrated database retrieval system