KEGG   Arthrobacter sp. Rue61a: ARUE_c02340Help
Entry
ARUE_c02340       CDS       T02215                                 

Gene name
pme
Definition
pectinesterase Pme (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARUE_c02340 (pme)
   00500 Starch and sucrose metabolism
    ARUE_c02340 (pme)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ARUE_c02340 (pme)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(243761..245743)
Genome map
AA seq 660 aa AA seqDB search
MRLRRLLGAATAVVILGSLTAVPARAEPIHSGTESPAAPAALWKQRPDGFASLPGNGLDG
TTGGQAGRHVSVSSLEELKTHAAAEEPLVIFLKGSITAQDYVKVPVASNKSFIGTGAGVE
LINAGFKLINVSNVIFRNFTVRDSYIPGDWDGKRPDNDRDGIQLDTSHHVWVDHMKFERM
GDGMIDTRKDSDYLTYSWNVFADNNKALGVGWTGNAVTKMTIHHNWIRNTVQRNFSLDNT
AAAHVYNNYLQDIGRYGMMGRNAAKVVLEGNYFTAVADPVVAKDPATEIVNRDNIFESTR
GRKDNVGSAFDPTQFYSYAKDDSARVPELVTGSAGPRENKAPSTTAEVTVALDGTGDFGS
VQAAIGSIPVGNTQPRTITIKPGFYREAVNVWADRPNVTLQGATANPADVVISYDTPANG
AKFFGGTWGAAGSATLNVLAENTTVRNLTVENAYDEAVHGGSQALAVRTVADKITFDNTR
FLGNQDTYLADTTGRDATARTYLKNCYIEGDVDFLYGRGTAVFDGCTIHSLDRGSDTNNG
YIVAPSTKDSNPYGFLIVDSTLTSDAAPGTVSLGRPWFASSDPNAHPMAVIRDSNLGSHI
AEQGWSDMSGHAWTEGRFAEFNNTGPGAYINEFHPQLTPEEALKFTKDTFLGDWTPAAGA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcgacgcctactcggcgcggccaccgccgtcgtcattcttggaagccttacc
gctgtgcctgccagggcggagcccatccacagcggcacagaatcaccggcggcaccggcg
gccctgtggaagcaacgtcccgacggtttcgcgtcccttcccggcaacggcctggacggc
accaccggaggccaggcggggaggcacgtgagcgtgtcctcgctggaggaactcaaaacc
catgccgcggccgaggagccgctggtgatcttcctcaagggcagcatcacggcccaggac
tacgtcaaggttccggtcgcctcgaacaagagcttcatcggtacgggcgcgggcgtggag
ctgatcaatgccggcttcaaactcatcaacgtgtccaacgtgatcttccggaacttcaca
gtccgtgactcctacattcccggcgactgggacggcaagcgcccggacaacgaccgtgac
gggatccaactggatacctcgcaccatgtctgggtggaccacatgaagttcgagcgcatg
ggcgacggcatgatcgatacccgcaaggactcggactacctgacctactcgtggaacgtg
ttcgcggacaacaacaaagccttgggcgttggctggaccggcaacgcagtcaccaaaatg
accatccatcacaactggatccgcaacactgtccagcggaacttcagcctggacaacaca
gcggctgcgcacgtctacaacaactacctgcaggacatcggacggtacggaatgatgggc
cgcaacgccgccaaggtggtcctggagggcaactacttcaccgcggttgccgatcccgtg
gtggcaaaggaccctgccacggaaatcgtcaaccgtgacaacattttcgagtccacccgc
ggccgcaaggacaacgtcggcagcgccttcgaccccacacagttctattcatacgccaag
gacgactctgcgagggttcccgaactggtcaccggcagtgccggacctcgcgaaaacaaa
gcaccaagcacgacggcggaggtcacggtcgcgctggacggcaccggcgatttcggcagc
gtacaggcggccatcggctcgattcctgtgggcaacacacaaccccggaccatcaccatc
aagcccggcttctaccgggaagcggtgaatgtctgggccgaccggcccaacgtgacgttg
cagggagcaacagccaacccggccgacgtcgtcatttcctacgacacccctgcaaacggc
gcgaagttcttcggcggaacctggggcgctgcgggcagtgccacgctcaacgtcctggcg
gaaaacaccacggtccggaacctcacagtggaaaacgcttatgacgaggccgttcacgga
ggtagccaggccctcgcggtgcggacggtggcagacaaaatcaccttcgacaacaccagg
ttcctcggcaaccaggacacctacctcgcagacaccaccggccgtgacgctaccgcccgc
acctatctgaaaaactgctacatcgaaggtgacgtggacttcctctacggccgcggcaca
gcggtgtttgacggctgcaccatccattcgctggaccgcggcagcgacacgaacaatggc
tacatcgtggcacccagcaccaaggactccaacccttacggcttcctgatcgtggacagc
accctgacctctgacgctgcacccgggaccgtcagtttgggacgcccttggtttgccagc
agcgaccccaacgcgcaccccatggccgtcatccgggactcgaacctgggcagtcacatc
gctgagcagggctggtcagacatgagtggtcatgcttggactgaagggcgcttcgctgag
ttcaacaacaccgggcccggcgcatacatcaacgagttccacccccaactcactccggaa
gaggccctgaaattcactaaggacacgttcctcggtgactggactccggcagcaggtgct
taa

DBGET integrated database retrieval system