KEGG   Arthrobacter sp. Rue61a: ARUE_c04490Help
Entry
ARUE_c04490       CDS       T02215                                 

Definition
aldehyde-dismutating formaldehyde dehydrogenase, glutathione-independent (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:arr01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:arr00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:arr00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(456457..457680)
Genome map
AA seq 407 aa AA seqDB search
MTMSGNRAVAYKEPGVVEIIDTDYPTFELKDGPGVNPANVGRKVPHGAILRTVTTNICGS
DQHMVRGRTTAPQDLVLGHEITGEVVEVGPDVEFIKVGDIVSVPFNISCGRCRNCKEQKT
GICLNVNPDRPGSAYGYVDMGGWVGGQAEFVLVPYADWNLLRFPDRDQALEKIMDLTMLS
DIFPTGFHGAVTAGVGVGSTVYVAGAGPVGLAAAVGAQLLGAAVVIVGDMNEDRLAQARS
FGCETVNVSNGDPKEQIAQILGVPEVDCGVDAVGFEARGHGKDASHEAPATVLNSLMDIT
AAGGSLGIPGLYVTGDPGGIDDAAKHGSLSLSLGTGWAKSLSFTTGQCPVMKYNRQLMMA
ILHDKVQIAKAVNAKAIPLEDAPRGYAEFDAGAATKFVLNPNGYVKA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatgtcaggaaacagagcagtcgcctacaaggaacctggtgtcgtggagatcatt
gacactgactacccaacgtttgagctcaaggacgggccgggcgtcaacccagccaacgtc
gggcggaaagtgccgcatggcgcgatcctgcgaaccgtgaccaccaatatttgcggttcg
gaccagcacatggtccggggtcgcaccacagccccgcaggacctggtcctcggccacgaa
atcaccggcgaagtggtggaagtagggcccgacgtcgagttcatcaaggtgggcgacatc
gtctccgtgccgttcaacatctcctgcggccgctgccggaactgtaaagaacagaagacc
ggcatctgcctcaacgtcaaccccgaccgccccggcagcgcctacggctacgtcgacatg
ggaggctgggtgggcggacaagcagagttcgtcctggttccctacgccgactggaacctg
ctgcgcttcccggaccgcgatcaggccctggaaaagatcatggacctgaccatgctctcg
gacatcttccccaccggcttccacggcgccgtcaccgccggcgtgggcgtaggctccacc
gtttacgtggcaggtgccgggcccgtgggccttgctgctgccgtcggcgctcagctgctt
ggcgccgccgtcgtgattgtgggcgacatgaacgaggaccgcctggcacaggcgcgctcc
ttcggctgcgaaaccgtcaacgtgtccaacggcgatccgaaggagcagatcgcacagatc
ctcggcgtgcctgaggtggactgcggcgtggacgcggttggtttcgaagcccgcgggcac
ggtaaggatgcctcccacgaggctccggccaccgtattgaactccctcatggacatcacg
gccgccggcggatccttgggtatcccgggcctctacgtcacgggcgacccgggcggaata
gacgacgcagccaagcacggttccctttcgctgtccctgggcacgggctgggccaagtcc
ttgtccttcaccaccggccaatgcccggtcatgaagtacaaccgtcagctgatgatggcc
atcctccatgacaaggtccagatcgccaaggcagtcaacgccaaagccatcccgctcgaa
gacgctccgcgcggctacgccgaattcgacgcgggcgcggcaacaaagttcgtgctgaac
cccaacggctacgtgaaggcgtag

DBGET integrated database retrieval system