KEGG   Arthrobacter sp. Rue61a: ARUE_c04700Help
Entry
ARUE_c04700       CDS       T02215                                 

Gene name
hibCH
Definition
3-hydroxyisobutyryl-CoA hydrolase (EC:3.1.2.4)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARUE_c04700 (hibCH)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ARUE_c04700 (hibCH)
   00650 Butanoate metabolism
    ARUE_c04700 (hibCH)
  Lipid metabolism
   00071 Fatty acid degradation
    ARUE_c04700 (hibCH)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARUE_c04700 (hibCH)
   00310 Lysine degradation
    ARUE_c04700 (hibCH)
   00360 Phenylalanine metabolism
    ARUE_c04700 (hibCH)
   00380 Tryptophan metabolism
    ARUE_c04700 (hibCH)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARUE_c04700 (hibCH)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ARUE_c04700 (hibCH)
   00281 Geraniol degradation
    ARUE_c04700 (hibCH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ARUE_c04700 (hibCH)
   00627 Aminobenzoate degradation
    ARUE_c04700 (hibCH)
   00930 Caprolactam degradation
    ARUE_c04700 (hibCH)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ARUE_c04700 (hibCH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482099..483172
Genome map
AA seq 357 aa AA seqDB search
MESVGSEEEVLFERRGNLGIVTLNRPKAVNALNAGMVKTMLSQLTDWAADDAVATVLVRG
AGDRGLCAGGDIVAIYKDMLHGGTETAEFWADEYRLNALISHYPKPYVAFMDGLVLGGGV
GISAHGSVRVVTERTRTGMPETTIGFVPDVGGTLLLSRSPGETGTHAGLTGAHLSGADAL
FLGLADHFVPSQSLPALAEALESSTATAAVERFAQAAPDSALAAQREWIDAAYAHDDAEE
IVRSLRTLGDEAAAAADTIEAKSPTSVKVALESLRRVHGMSLEEALDQEYRVGLRCLAGP
DFREGIRAQVVDKDRNPQWKPATLAEVQASDVEGYFAPLGERELGLTRLSSQLKETT
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagtctgtggggtcagaggaagaagttctgtttgagcgccgcggcaatctgggcatc
gtgacgctcaatcgccccaaggcagtcaacgcactgaacgctggaatggtgaaaaccatg
ctcagccagttgacggattgggcggccgacgacgccgttgccaccgttttggtgcgcggc
gcgggcgaccgtgggctgtgcgccggtggcgacatcgtggccatttacaaggacatgctg
cacggcggcacggagacggccgagttctgggctgacgaataccggctcaacgcgctcatc
tcgcactatcccaagccatacgtcgcgttcatggacgggctggttttgggtggcggcgtg
ggtatttcggcgcacggttccgttcgcgtggtcaccgagaggacgcgcaccggcatgccg
gaaaccaccatcggtttcgtccccgacgtcggaggcacccttttactttcacgctcaccg
ggggagaccggaacgcatgcagggttgaccggagcgcacttatccggtgcggacgcactg
ttcctggggctcgcggatcacttcgtgccgtcccaaagcctccccgcgttggcggaagcg
ctggaaagctcgacggcgacggccgccgtcgagcgctttgcccaagccgcgccggactcg
gctctcgcggcacagcgggagtggatcgacgccgcgtacgcgcatgacgatgctgaggaa
attgtgcggagccttcggactttgggcgacgaagcagccgccgcggcggacacgatcgag
gcgaaatccccaacgtccgtgaaggtggcgcttgagtccttgcggcgggtccatgggatg
tccctcgaagaagcactggaccaggaataccgagtgggcttgcgatgcctggccgggcct
gatttccgggagggcatccgcgcacaggtggtggacaaggaccgtaacccgcagtggaag
ccggcgacgctcgctgaagtccaggcgtccgacgtcgagggctacttcgcgccgctcggc
gaacgggagttgggactgaccagactaagcagccagttgaaggagacgacatga

DBGET integrated database retrieval system