KEGG   Arthrobacter sp. Rue61a: ARUE_c04720Help
Entry
ARUE_c04720       CDS       T02215                                 

Gene name
echA
Definition
enoyl-CoA hydratase EchA (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARUE_c04720 (echA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ARUE_c04720 (echA)
   00650 Butanoate metabolism
    ARUE_c04720 (echA)
  Lipid metabolism
   00071 Fatty acid degradation
    ARUE_c04720 (echA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARUE_c04720 (echA)
   00310 Lysine degradation
    ARUE_c04720 (echA)
   00360 Phenylalanine metabolism
    ARUE_c04720 (echA)
   00380 Tryptophan metabolism
    ARUE_c04720 (echA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARUE_c04720 (echA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ARUE_c04720 (echA)
   00281 Geraniol degradation
    ARUE_c04720 (echA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ARUE_c04720 (echA)
   00627 Aminobenzoate degradation
    ARUE_c04720 (echA)
   00930 Caprolactam degradation
    ARUE_c04720 (echA)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ARUE_c04720 (echA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484156..484935
Genome map
AA seq 259 aa AA seqDB search
MTEQYQNIVVEHRGRVGLVTLNRPEALNALNTALMNELVDAVTAMDTDPDVGAVVITGSA
KAFAAGADIKEMSSNSYMEMYAADWFRRWEDLTRLRIPVVAAVSGFALGGGCELAMMADF
IIAGDNAKFGQPEINLGVIPGMGGSQRLTRAVGKAKAMDMVLTGRFMDAEEAERSGLVSR
VVPAAEVIDEALKAAEVIASKSKPAAMVAKEVVNAAFEMGLAQGVVFERRVFHSLFATED
QKEGMAAFSEKRQPEFKHR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcagtatcagaacatcgtggttgaacatcggggacgggttggtttggtgaca
ctgaaccggcccgaggctctgaacgcgctcaatactgctctcatgaatgagctcgtggac
gctgttacggccatggacactgatccggacgttggggccgtggtgatcacgggatcggct
aaagcgtttgctgccggagctgacatcaaggagatgtcttccaacagctacatggagatg
tatgcagcggactggttccggcgttgggaggacctcacccggctccgcatccctgttgtt
gctgcagtgtccggctttgccctgggcggaggctgcgaactggccatgatggccgacttc
atcatcgccggggacaacgccaagttcggccagcccgagatcaacctgggcgtgatcccg
ggaatgggtgggtcccagcggctcacccgggcggtgggcaaggcgaaagccatggacatg
gtcctgacggggcggttcatggatgccgaagaggctgaacgctccggcttggtgtcccgt
gttgttcccgccgcagaggtgatcgacgaggctcttaaggctgccgaagtcatcgcctcc
aagtcgaagcccgccgcgatggtggccaaggaagtcgtcaacgcagcctttgagatgggt
ttggcgcagggcgtggtgtttgaacgcagggtgttccactctctctttgccaccgaggac
cagaaggaaggcatggctgcgttcagcgagaagcgtcagccggagttcaagcacaggtag

DBGET integrated database retrieval system