KEGG   Arthrobacter sp. Rue61a: ARUE_c06830Help
Entry
ARUE_c06830       CDS       T02215                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c06830
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARUE_c06830
   00630 Glyoxylate and dicarboxylate metabolism
    ARUE_c06830
Enzymes [BR:arr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ARUE_c06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(713670..715322)
Genome map
AA seq 550 aa AA seqDB search
MNSFTDNFTINGITITAQPICRQNEVLTPDALEFIGKLHRATADRRQELMQARHARRNQI
SGGQDPRFLPQTEAIRNDPSWRVAPPAPGLEDRRVEITGPVDKKMTINALNSGAKVWLAD
MEDSSTPTWRNVIQGQLNLTDALERRIDFTSPEGKEYKLKAAEDLPTIVVRPRGWHLPEK
HMLIDRKPIAGGIVDFGLFFFHNARRLIAQGKGPYFYLPKIENHLEARLWNDIFVLAQDL
LGIPQGTIRTTVLIETITAAFEMEEILYELRDHASGLNAGRWDYIFSLIKNFRTRGPRFV
LPDRGQVTMTQPFMRAYTEQLVRACHRRGAMAIGGMAAAVPNRKDEAANQASFEKVRADK
TREANDGFDGSWVAHPDLVPVCREVFDEVLGDRPNQLDRSREDVTPDDRALIDIASTEGT
ITEGGVRLNIEVGIRYIESWLRGNGAVAIHNLMEDAATAEISRSQLWQWIHSHAITDHGD
IITREWVEDMLDEEYARLERFDGDRFADARAIFEEVTLAEEFPTFLTIPAYARFLTEARE
EATEEELVAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcactgacaacttcactatcaatggcatcaccatcaccgcgcagcccatt
tgccggcagaacgaggtcctcacgccggacgccctcgagttcattggcaagttgcaccgg
gcgacggcggatcgtcgtcaggagctgatgcaggcacggcacgcccgccgcaaccaaatt
tcggggggccaggatccacggttcctgccgcagaccgaagccatccggaatgacccgtcg
tggcgtgtcgctcccccggcgccgggcttggaggatcgtcgcgtcgagatcacgggcccg
gtggacaagaagatgaccatcaacgccctgaactccggtgccaaggtttggttggctgac
atggaagactcgtccacaccgacgtggcggaacgtgatccaagggcagctgaacctgacc
gatgctttagagcgccggatcgatttcacttctcctgagggcaaggaatacaagctcaag
gccgccgaggacctgcccaccatcgtggtccgcccccgtggctggcatctgccggagaag
cacatgctgatcgatcgcaagccaatcgccggaggcatcgtggacttcgggctgttcttc
ttccacaacgcccgccgcctgatcgcccagggcaagggcccgtacttctacctgccgaag
atcgagaaccacctcgaagcccgcttgtggaatgacattttcgtcctggcccaggacctg
ctcggcatcccgcagggcaccattcgcaccacggttctgatcgaaaccatcacggctgcg
ttcgagatggaagagatcctgtacgagctgcgtgaccacgcttcgggtttgaacgccgga
cgttgggactacattttctccctgatcaagaacttccgcacccgcggaccgcgtttcgtc
ctcccggaccgcggccaggtgaccatgacccagccgttcatgcgtgcctacacggagcag
ctggtccgggcttgccaccgccgcggggccatggcgatcggtggcatggctgctgctgtt
cccaaccgcaaggacgaagcagcaaaccaggcttcgttcgagaaggtccgtgcggacaag
acccgtgaggccaacgacggcttcgacggttcatgggtggcccacccggacctggtgccg
gtgtgccgggaagtctttgacgaagttctcggagaccgccccaaccagctggaccgttca
cgcgaggacgtcactcccgatgaccgcgcactgatcgacatcgccagcaccgagggcacc
atcaccgagggcggggttcgcctgaacatcgaagtgggcatccgctacatcgagtcctgg
ctgcggggcaacggagctgtggccatccacaacctcatggaagacgccgccaccgcggag
atctcccgctcccagctgtggcagtggatccactcccacgccatcactgaccacggtgac
atcattacccgcgaatgggttgaggacatgctggatgaggaatacgcccgcctggaacgc
ttcgacggagaccgcttcgctgatgcccgcgccatcttcgaagaagtcaccctggccgag
gaattccccaccttcctgaccatccccgcgtacgcccgtttcctcactgaggcccgtgaa
gaggccacggaggaggaactcgtcgcggcctag

DBGET integrated database retrieval system