KEGG   Arthrobacter sp. Rue61a: ARUE_c06830Help
Entry
ARUE_c06830       CDS       T02215                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c06830
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARUE_c06830
   00630 Glyoxylate and dicarboxylate metabolism
    ARUE_c06830
Enzymes [BR:arr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ARUE_c06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(713670..715322)
Genome map
AA seq 550 aa AA seqDB search
MNSFTDNFTINGITITAQPICRQNEVLTPDALEFIGKLHRATADRRQELMQARHARRNQI
SGGQDPRFLPQTEAIRNDPSWRVAPPAPGLEDRRVEITGPVDKKMTINALNSGAKVWLAD
MEDSSTPTWRNVIQGQLNLTDALERRIDFTSPEGKEYKLKAAEDLPTIVVRPRGWHLPEK
HMLIDRKPIAGGIVDFGLFFFHNARRLIAQGKGPYFYLPKIENHLEARLWNDIFVLAQDL
LGIPQGTIRTTVLIETITAAFEMEEILYELRDHASGLNAGRWDYIFSLIKNFRTRGPRFV
LPDRGQVTMTQPFMRAYTEQLVRACHRRGAMAIGGMAAAVPNRKDEAANQASFEKVRADK
TREANDGFDGSWVAHPDLVPVCREVFDEVLGDRPNQLDRSREDVTPDDRALIDIASTEGT
ITEGGVRLNIEVGIRYIESWLRGNGAVAIHNLMEDAATAEISRSQLWQWIHSHAITDHGD
IITREWVEDMLDEEYARLERFDGDRFADARAIFEEVTLAEEFPTFLTIPAYARFLTEARE
EATEEELVAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcttcactgacaacttcactatcaatggcatcaccatcaccgcgcagcccatt
tgccggcagaacgaggtcctcacgccggacgccctcgagttcattggcaagttgcaccgg
gcgacggcggatcgtcgtcaggagctgatgcaggcacggcacgcccgccgcaaccaaatt
tcggggggccaggatccacggttcctgccgcagaccgaagccatccggaatgacccgtcg
tggcgtgtcgctcccccggcgccgggcttggaggatcgtcgcgtcgagatcacgggcccg
gtggacaagaagatgaccatcaacgccctgaactccggtgccaaggtttggttggctgac
atggaagactcgtccacaccgacgtggcggaacgtgatccaagggcagctgaacctgacc
gatgctttagagcgccggatcgatttcacttctcctgagggcaaggaatacaagctcaag
gccgccgaggacctgcccaccatcgtggtccgcccccgtggctggcatctgccggagaag
cacatgctgatcgatcgcaagccaatcgccggaggcatcgtggacttcgggctgttcttc
ttccacaacgcccgccgcctgatcgcccagggcaagggcccgtacttctacctgccgaag
atcgagaaccacctcgaagcccgcttgtggaatgacattttcgtcctggcccaggacctg
ctcggcatcccgcagggcaccattcgcaccacggttctgatcgaaaccatcacggctgcg
ttcgagatggaagagatcctgtacgagctgcgtgaccacgcttcgggtttgaacgccgga
cgttgggactacattttctccctgatcaagaacttccgcacccgcggaccgcgtttcgtc
ctcccggaccgcggccaggtgaccatgacccagccgttcatgcgtgcctacacggagcag
ctggtccgggcttgccaccgccgcggggccatggcgatcggtggcatggctgctgctgtt
cccaaccgcaaggacgaagcagcaaaccaggcttcgttcgagaaggtccgtgcggacaag
acccgtgaggccaacgacggcttcgacggttcatgggtggcccacccggacctggtgccg
gtgtgccgggaagtctttgacgaagttctcggagaccgccccaaccagctggaccgttca
cgcgaggacgtcactcccgatgaccgcgcactgatcgacatcgccagcaccgagggcacc
atcaccgagggcggggttcgcctgaacatcgaagtgggcatccgctacatcgagtcctgg
ctgcggggcaacggagctgtggccatccacaacctcatggaagacgccgccaccgcggag
atctcccgctcccagctgtggcagtggatccactcccacgccatcactgaccacggtgac
atcattacccgcgaatgggttgaggacatgctggatgaggaatacgcccgcctggaacgc
ttcgacggagaccgcttcgctgatgcccgcgccatcttcgaagaagtcaccctggccgag
gaattccccaccttcctgaccatccccgcgtacgcccgtttcctcactgaggcccgtgaa
gaggccacggaggaggaactcgtcgcggcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system