KEGG   Arthrobacter sp. Rue61a: ARUE_c07750Help
Entry
ARUE_c07750       CDS       T02215                                 

Definition
(GenBank) putative transcriptional regulator/glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00010  Glycolysis / Gluconeogenesis
arr00052  Galactose metabolism
arr00500  Starch and sucrose metabolism
arr00520  Amino sugar and nucleotide sugar metabolism
arr00521  Streptomycin biosynthesis
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
arr01200  Carbon metabolism
Module
arr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c07750
   00052 Galactose metabolism
    ARUE_c07750
   00500 Starch and sucrose metabolism
    ARUE_c07750
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c07750
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ARUE_c07750
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARUE_c07750
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ARUE_c07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFR27707
UniProt: J7LQL9
Position
complement(815634..816614)
Genome map
AA seq 326 aa AA seqDB search
MTHVIGVDLGGTKTAAGVVSPAGEVLMSETIPTLNRAGGEAILDATAALIAGLVERAADA
GHSVSSVGIGSAGVIDASSGTVVSATDAILGWAGTELVSGLSSRLSLHPSAVRAVNDVHA
HALGEAWLGAAAGSSSSLMVAFGTGVGGSFVLDGAPVLGHRFVGGHVGHFASPYAAFDGT
PLPCVCGGSGHVEAIASGPAIYESFLRFGGSAVDAADTRDVFALAASEDHDGGAAAGSAG
DRAAALRAIGVGAAAAGQAVGGLINVLDPETVVISGGLADAGELWWKPMEFALRQELLAP
LVSVPVVRATLGNTAAIVGAAKLVLK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgtgatcggcgttgacctcggcggcaccaagactgccgccggggttgtttcc
cctgcaggtgaagtgctcatgtcggagaccattccgacgttgaaccgggctggtggcgaa
gcgatcctcgacgccaccgctgcgctgattgcgggcttggtggagcgcgctgccgacgcc
ggacattcagtgtccagcgtcggtatcggctccgccggggtcattgacgcttcttccggg
accgtggtgtctgcgacggatgcgattcttggctgggcagggactgagcttgtttccggg
ctttcgtcccgtctgtcgcttcatccttcggccgtgcgcgccgtcaacgacgtccatgcc
cacgccctcggcgaagcatggctcggcgctgcggccggatcctcaagttcgctcatggtg
gcgttcggaacgggagtcggcggaagctttgtgctggacggcgctcctgtcttgggtcac
cgttttgttggcgggcatgtggggcacttcgcttctccttacgccgcctttgacgggact
ccgctcccctgcgtgtgcggtggttccgggcatgttgaggccatcgcttcggggcccgcg
atttacgagtctttcctgcggtttggcggttccgctgtggatgcggcggacacgcgggac
gtgtttgccctggccgcttctgaagaccacgacggcggtgctgccgcgggctctgctggg
gaccgcgccgccgctttgcgtgccatcggcgtcggcgcggcagcagccggacaagcagta
ggcggtctcatcaacgtcctggaccctgaaaccgtggtgatctccggtggcttggccgac
gccggcgagctctggtggaagcctatggagtttgccttgcgacaggaactgctggctccc
ttggtttccgtgcccgtggtgcgggcgactctcggcaataccgccgccattgttggcgcc
gcaaaactcgtccttaagtag

DBGET integrated database retrieval system