KEGG   Arthrobacter sp. Rue61a: ARUE_c08630Help
Entry
ARUE_c08630       CDS       T02215                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARUE_c08630 (glgB)
Enzymes [BR:arr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     ARUE_c08630 (glgB)
Exosome [BR:arr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARUE_c08630 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
914237..917893
Genome map
AA seq 1218 aa AA seqDB search
MSKANLNPSIEGLLRNWLPGKRWFPVKSPDFALEQVGRFSLPGTGAEAGLEVVLLAVTHR
TADGGSRTDVVQVPLSYRSQPLTDAPSALLGEFTDPDLGLRLVYDAVYDADFVTAWLELM
RSEGTVAGARGHLTRGRVALPKNPTSVKVLSGEQSNTSVIIDDGDSAAIVKIFRVLAAGK
NPEVELGAALTAAGTTEVPATLGWITGSWDGPASNGSAAATGELTVAHEFLLGGLDAWRR
AVEAAAAGKDFTAEARGLGAATATVHARLAETFGTHDGQEQGPDIIATVARRVRGSWAEA
SAAVGPYDHELDELLSALDPRDVGQLQRVHGDLHLGQILLVPGAEGQPGRWAILDFEGEP
LRTIDERNSPDLPLRDVTGMLRSFDYAAGAATRENAHANVPETWVDDCAAAFLEGYSEVT
PGTIDRRSPLFVALWLDKALYEVVYELRNRPDWLSIPVNASRRILDNTSRGKHAAATAEG
NDMTGSARTERPRVPLHVDSETLERVAAGAYHAPHSVLGAHLDDHGHVTIRTVKHLAKSV
VVVTEAGRTDMTHEAHGVWAAVLEPLQAGHVPDYRLEVVYDAEPVTIDDPYHYLPTVGEV
DLHLIGEGRHERLWDVLGAHVQHYRSALSEVDGVSFAVWAPNAQAVRVKGDFNGWDGRQH
GMRSLGSSGVWELFIPGVVAGACYKYEILTKAGQWVEKADPMAFGTEVPPLTASRVVDAS
YRFKDAEWMSARAQRDPHNSPMSVYEVHLGSWRLGLGYKELAKELVDYVKWLGFSHVEFM
PVAEHPFGGSWGYQVTSYFAPTSRFGHPDEFRFLVDSLHQAGIGVLLDWVPAHFPKDSWA
LAQFDGQPLYEHSDPALGEHPDWGTLIFDFGRSEVRNFLVANALYWLEEFHIDGLRVDAV
ASMIYLDYSREEGQWRPNKFGGRENLEAISFMQEVNATVYKSHPGAIIIAEESTAFPGVT
APTNHGGLGFGLKWNMGWMHDSLKYISEDPINRKWHHGTITFSLVYAFTENFLLPISHDE
VVHGKGSMLRKMPGDRWQQLANLRAFFAYQWAHPGKQLIFMGTEFGQEAEWSEQYGLDWF
LAEIPAHRGLQLLVKDLNELYTSTPALYQRDNEPGGFQWINGGDADHNVLTFIRWDGDGK
PLVCAVNFSGGPHKDYILGVPAAGEWTEVLNTDSETYGGSGVGNPGSLKASTPGTDGQPA
ALTVTLPPLGASWFAPAE
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcaaacttgaacccctccattgaaggacttctccggaactggctgccaggc
aagcgctggttccccgtcaagagccccgacttcgcgctcgagcaggtgggcagattcagc
ctcccgggtaccggcgcggaggccggattggaagttgtgctgctggcggtaacccaccga
actgccgacggcggttcgcggaccgacgtcgtccaggttccgttgagttaccggagccag
ccgctcacggatgctcccagtgcgttgttgggcgagttcacggatcctgaccttggcctg
cggctggtatacgacgccgtctacgatgcggattttgtgacggcgtggctggaactcatg
cgcagtgaaggaaccgtggccggcgcccgggggcatctcacccgtggccgcgtcgcgctt
ccaaaaaatcccacctcggtcaaggtcctgtccggcgagcagtccaacacgtccgtcatt
atcgacgacggcgattcggcagcgatcgtcaaaattttccgtgtgcttgcggcaggtaaa
aatcccgaagtcgaacttggtgccgccctgacggcggccgggactaccgaggttcccgcg
acgctcggttggataaccggctcgtgggacgggccggcgtcgaacggttccgcagcggcc
acgggtgagctgaccgtcgcccacgaattccttctcggaggcctcgatgcctggagacgg
gcagtggaggcagccgcagccggcaaggatttcacggcagaggcccgcgggctcggggct
gctactgccacggttcacgcgaggctcgcggagacgttcggaacccacgacggccaggaa
cagggcccggacatcatcgcgactgtggcccggcgtgtccgcggctcatgggccgaagcc
tcggccgccgtcgggccctacgaccacgagctcgatgagctgttgtcggctctggatccc
cgggacgtcggccagttgcaacgcgttcacggcgacctccacctgggacagatccttctg
gttcccggcgctgaggggcagccgggacggtgggccatcctcgacttcgagggcgagccg
ctccggaccatcgatgaacgtaacagccccgatcttcccctgcgggatgtcacaggcatg
ctgcggtcgttcgactatgcagcgggtgccgctacgcgcgaaaacgcccacgccaacgtg
cccgagacctgggtggatgattgcgccgccgcgttccttgagggttacagcgaagtcacc
ccgggaaccatagaccgccgctcgccgctctttgtggcattgtggctggacaaggcctta
tacgaggttgtttacgagttgcggaaccggcccgactggctgtcaattccggtgaatgca
tcccgacgaatcctcgacaacacaagccgcggcaagcatgcggcagctacagcggaaggt
aatgacatgactggctctgcacgcaccgaacggccccgagtacccctgcacgtggactcc
gagaccttggaacgcgtggcggccggcgcttaccacgcgccgcactcagttcttggtgcc
cacttggacgaccatggccacgtcaccatccgcaccgtgaagcacctcgcgaagtccgtc
gttgtggtgacggaagccggccgtactgacatgacccatgaggcccacggggtctgggca
gcggtcctggaaccgctgcaggcaggccatgtgccggactaccgtttggaagtggtgtac
gacgccgaacccgtcaccatcgatgacccctaccactacctgcccaccgtgggtgaggtg
gacctgcacctgatcggcgaaggacgccacgaacgcctctgggatgtcctcggcgcgcac
gtccagcactatcgctcggccttgagcgaggtggacggggtctcgttcgctgtttgggct
ccaaatgctcaggctgttcgcgttaagggcgacttcaacgggtgggatggccgccagcac
gggatgcgttccttgggctcctccggtgtgtgggaactcttcattcccggggttgtagca
ggggcgtgctacaaatacgagatcctgaccaaggcgggtcagtgggtggagaaagccgac
ccgatggccttcggcaccgaggtcccgccgctcacagcctcccgtgtggtggacgccagt
taccggttcaaggacgcggaatggatgagtgcccgtgcccagagggacccgcacaactcg
cccatgagcgtttacgaagtccatttgggctcctggcggttgggccttggctacaaggaa
ctcgccaaggaacttgtggactacgtgaagtggcttgggttctcccatgttgagttcatg
ccggtcgcggagcaccccttcggtggatcgtggggctaccaagtgacgtcctacttcgcc
ccgacgtcgcggttcggacacccggacgagttccggttcctggtggattcactgcaccaa
gcgggcatcggcgtactcctcgactgggtccccgcacacttccctaaggattcctgggcg
ctggcgcagttcgacggccagcctctgtacgagcactcggaccccgccctgggtgagcac
cccgactggggaacgctgatcttcgacttcggacgcagcgaggtccgcaacttccttgtt
gccaacgcgctgtactggctggaggagttccacatcgatggcctgcgcgtggatgccgtg
gcctccatgatctacctggactactcccgtgaggaaggacagtggaggcccaataagttc
ggcggccgcgagaaccttgaagccatctccttcatgcaggaagtcaatgccaccgtctac
aagtcccaccccggcgccatcatcatcgccgaggaatcaacggcattccccggtgtcacg
gcgcccaccaaccacggcggactcggcttcggtctcaagtggaacatgggctggatgcac
gactcgctcaagtacatctccgaagaccccattaaccgcaaatggcaccacggcaccatc
acgttctccctggtctacgccttcacggagaacttcctgctgcccattagccacgacgaa
gtagttcacggcaagggatccatgctgcgcaagatgcccggtgaccgctggcagcagctg
gcaaacctgcgggcgttctttgcttatcagtgggcgcatccgggcaagcagctgatcttc
atgggcacggagttcggtcaggaagcagagtggtccgagcaatacggactggactggttc
cttgctgagattcctgcgcaccgcggactgcaactcctggtcaaggatcttaacgagcta
tacacgtcgacgcctgccctgtaccagcgggacaacgagcccggcggtttccagtggatc
aatggcggagatgccgaccacaatgttctgactttcatccgatgggatggcgatggcaag
ccgttggtttgcgccgtgaacttctcgggcggtccccacaaggactacatcctgggtgtg
cccgccgcaggggagtggacggaagtcctgaacaccgattcggagacatatggcggctcg
ggggtcggtaacccgggatcgttgaaggcttcgactcccgggactgatggccagcctgca
gcgctgaccgtcacgctccctccgctcggcgcttcctggttcgcgccggctgagtaa

DBGET integrated database retrieval system