KEGG   Arthrobacter sp. Rue61a: ARUE_c09980Help
Entry
ARUE_c09980       CDS       T02215                                 

Gene name
sucC
Definition
succinyl-CoA ligase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c09980 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARUE_c09980 (sucC)
   00640 Propanoate metabolism
    ARUE_c09980 (sucC)
   00660 C5-Branched dibasic acid metabolism
    ARUE_c09980 (sucC)
Enzymes [BR:arr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ARUE_c09980 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062338..1063477
Genome map
AA seq 379 aa AA seqDB search
MFEAHGVPVLAGIVAHTPEEAKAAAEKIGGVTVVKAQVKVGGRGKAGGVKVAKTAEEALE
HSTNILGMDIKGHTVNKVMIAQGADIAEEFYFSVLLDRANRNYLAMCSVEGGMEIEQLAV
ERPEALAKIAIDPAVGIDQAKADEIVAAAGFAEELRGKVADVILKLWDVFKKEDATLVEV
NPLVRTGAGEIVALDGKVSLDENADFRHVHHAHLEDKDAADPLEAKAKAQDLNYVKLDGE
VGIIGNGAGLVMSTLDVVAYAGENHGNVKPANFLDIGGGASAEVMANGLDVILGDSQVKS
VFVNVFGGITACDAVAKGIVGALAELGSSANKPLVVRLDGNNVEEGRRILTEANHPLVTL
AATMDEGADKAAELANAAK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggcgcacggtgtacccgtgctcgccggcatcgtggcgcacactcctgaagaa
gcgaaggcagctgccgagaagatcggcggcgtaactgtcgtaaaggcacaggttaaggtc
ggtggccgcggcaaggctggcggcgtcaaggttgccaagactgccgaagaggcgcttgag
cactccaccaacatcctgggcatggacatcaagggccacaccgtcaacaaggtgatgatc
gcccagggtgctgacatcgccgaggaattctacttctcggtcctcctggaccgcgccaac
cgcaactacctggccatgtgctcggtagaaggcggcatggaaatcgagcagcttgcagtt
gagcgtcccgaggccctggccaagatcgccatcgaccccgctgtgggcatcgaccaggcc
aaggctgacgagatcgtcgcagctgcaggtttcgctgaagaactgcgcggcaaggtagcc
gacgtcattctgaagctctgggacgtcttcaagaaggaagacgcaaccctggttgaggtc
aaccctctggtccgtaccggcgctggcgagatcgtcgccctcgacggcaaggtctccctg
gatgagaacgctgacttccgccacgtgcaccacgcacacctggaagacaaggacgcagct
gacccgctggaggccaaggccaaggcgcaggacctgaactacgtcaagctggacggcgaa
gtaggcatcatcggcaacggcgccggtcttgtgatgtccaccctcgacgtcgttgcttac
gccggcgagaaccacggcaacgtgaagcccgccaacttcctggacatcggtggtggagca
tccgccgaggtcatggccaacggtttggacgtcatccttggcgattcccaggtcaagagc
gtgttcgtgaacgtcttcggtggcatcactgcttgtgacgccgttgccaagggcatcgtc
ggtgcactggctgagctcggttcctccgcgaacaagccgctggtagttcgcctcgacggc
aacaacgttgaggaaggccgccgcatcctgaccgaggccaaccacccgctggttaccctg
gccgccaccatggacgagggcgccgacaaggccgccgagctcgccaacgcagctaagtaa

DBGET integrated database retrieval system