KEGG   Arthrobacter sp. Rue61a: ARUE_c10130Help
Entry
ARUE_c10130       CDS       T02215                                 

Gene name
gbh1
Definition
guanidinobutyrase Gbh (EC:3.5.3.7)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ARUE_c10130 (gbh1)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ARUE_c10130 (gbh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1079726..1080826
Genome map
AA seq 366 aa AA seqDB search
MIHLLKEWHILEELRIEANGNLGPIDSSRIPRYAGAATYARLPRLDQVSKADVTVVGVPF
DSGVSYRPGARFGANHVREASRLLRPYNPAWDVSPFENIQVADAGDMAVNPFNINEAIET
VQQNALDLTANGSKLVTLGGDHTIALPLLRAAAERAGEPIAMLHFDAHLDTWDTYFGAEY
THGTPFRRAVEEGILDTEAISHVGTRGPLYGKKDLDDDHRFGFGIVTSADVYYQGVLETV
AKIRDRIGNRPLYISVDIDVLDPAHAPGTGTPEAGGITSRELLEIIRGFRGMNLVGADIV
EVAPAYDHAEITGVAGSHVAYELVTLMADNAVEGDRLGAPNGYAQQALGARIAELAQATG
AAGDQR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgatccatctactcaaggagtggcatattttggaagagctccgtattgaggccaacggg
aacctcggccccatcgattcatcccgcatcccgcgctacgccggtgccgccacctatgcc
cgcctgccccgcctggaccaagtctcgaaggccgacgtcaccgttgttggcgtccccttc
gactccggcgtttcctaccgccccggcgcacgtttcggtgccaaccacgtacgtgaggcc
agccgcctgctgcgtccgtacaacccggcgtgggacgtgagcccgttcgaaaacatccag
gttgccgacgccggcgacatggccgtgaaccccttcaatatcaacgaggctattgagacc
gtccagcagaacgcgctggacctcacagctaacggcagcaagctggtcacccttggtggc
gaccacaccatcgccctcccgctcttgagggcagcagcggaacgagccggcgagcccatc
gccatgctccactttgacgcccacctggacacctgggacacgtacttcggcgccgagtac
acccacggcaccccgttccgccgtgcggtggaagaaggcatcctggacaccgaggccatc
agccacgtcggtacccgcggacccctctacggcaagaaggacctcgatgacgaccaccgc
ttcggctttggaatcgtcacttccgccgacgtctactaccagggcgtcctggaaacggtc
gcgaagatccgggaccgcatcggcaaccgcccgctgtatatctcagtggacatcgacgtc
ctggacccggcccacgcacccggcaccggcacccccgaagccggcggcatcaccagtcgc
gaactcctcgaaatcatccgtggcttccgcggcatgaacctcgtgggcgcggacatcgtg
gaagttgccccggcctacgaccacgcagagatcaccggtgttgcaggcagccacgtggcc
tacgagctcgtgaccctcatggcggataacgccgtggaaggcgaccggctcggcgccccc
aacggttacgcgcagcaggcactcggtgcccgcatcgcggagctcgctcaggcaaccgga
gcagccggagaccagcgatga

DBGET integrated database retrieval system