KEGG   Arthrobacter sp. Rue61a: ARUE_c10740Help
Entry
ARUE_c10740       CDS       T02215                                 

Gene name
rbsK1
Definition
ribokinase RbsK (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ARUE_c10740 (rbsK1)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ARUE_c10740 (rbsK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1149284..1150192)
Genome map
AA seq 302 aa AA seqDB search
MSTSLQPSAPISSLTLTVMGSINLDITATANRLPSPGETVGGGVLRQQPGGKGANQAVAA
ARLAGSSRMVGAVGHDEAGQNLLSAMAAAGVDVHDVSRADAATGTALVLVDGEGENQIMV
CPGANGAVNVDGVTFDDDEAVLCQLEVDQHVVLEAARRAKGFFALNAAPAMPLIPELLDR
CDLVIVNETEYELIPALRHAPLVAVTYGGEGSAIFVDGERVAEAPAVRVTEIANTIGAGD
AFCAALVLALRSGLEYSHALAAANAVGADAVRDASSQPALKPLEHYIEATRSSLAAGSAA
TK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgtccctgcagccttctgcgcccatttcgtccctcacactcacggtgatgggc
agcatcaacctcgatatcaccgccacagcaaaccgtctcccctcgccgggcgaaaccgtg
ggcggaggcgttctccgtcagcagcccggcggcaagggcgccaatcaggccgtcgccgcg
gcccggctcgcgggaagctcccgcatggtgggggccgtgggccacgacgaagcgggacag
aacctgctcagcgcgatggcggccgccggcgtcgacgtccacgacgtttcccgggcagat
gctgccacaggaacggcgctggtgctggtagacggtgagggcgagaaccagattatggtg
tgcccgggcgccaacggtgcagtgaacgtggacggtgtcactttcgacgatgacgaggcc
gtcctgtgccaactcgaagtggaccagcacgtggtgcttgaagccgcccgccgggccaag
ggattcttcgcactgaatgcggcccccgcgatgcccctcatcccggagttgctggatcgc
tgcgacctggtaatcgtgaatgagaccgagtatgaactcatcccggcactccgccacgca
ccattggtggccgtgacctacggcggcgagggttcggcgatcttcgtcgacggcgaacgg
gtggccgaggctccggcggtgcgggtcaccgagattgccaacacgatcggagccggggat
gctttctgtgcagcattggtcttggcgctccggtccgggttggaatactcgcatgctttg
gcagcggcgaatgccgtgggcgcggatgctgtccgtgatgcttcgtcccagcctgcactg
aagccgttggaacattacattgaggcgacgcggtcttctcttgcggcaggttcggcagcc
accaagtag

DBGET integrated database retrieval system