KEGG   Arthrobacter sp. Rue61a: ARUE_c11820Help
Entry
ARUE_c11820       CDS       T02215                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00020  Citrate cycle (TCA cycle)
arr00190  Oxidative phosphorylation
arr00650  Butanoate metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
arr01200  Carbon metabolism
Module
arr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
arr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
arr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARUE_c11820 (sdhD)
   00650 Butanoate metabolism
    ARUE_c11820 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ARUE_c11820 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Cyt_bd_oxida_II CybS
Motif
Other DBs
NCBI-ProteinID: AFR28103
UniProt: J7LNP5
Position
complement(1271484..1271960)
Genome map
AA seq 158 aa AA seqDB search
MTTIETPRSGKIGSGKIAPKYNRTGSSRGNFEMIAWLFMRLSGIVLVVLIFGHLFVNLLV
GEGIHAIDFGFVAGKWADPFWQFWDLAMLWLAMLHGTNGVRTIINDYAEKDSTRFWLKMV
LYAATLVIIILGTLVIFTFNPCPVVDGVQLPGGFCPAP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatcgagacaccacgcagtggaaaaatcgggtccgggaagatcgcaccgaag
tacaaccgcaccggctccagccgtggcaacttcgagatgatcgcctggctcttcatgcgt
ctctccggcatcgtcctggtggtgctgatcttcggccacctgttcgtcaacctgctggtg
ggcgagggcatccacgcaatcgacttcggcttcgttgccggcaagtgggccgatccgttc
tggcagttctgggaccttgccatgctgtggcttgccatgctgcacggcaccaacggcgtc
cgcaccatcatcaacgactacgccgagaaggattccacgcgcttctggctcaagatggtc
ctctacgcggccaccctggtcatcatcatccttggcacactggtgatcttcaccttcaac
ccgtgccccgtcgtcgacggcgttcagttgcctggtggtttctgcccggccccgtag

DBGET integrated database retrieval system