KEGG   Arthrobacter sp. Rue61a: ARUE_c11940Help
Entry
ARUE_c11940       CDS       T02215                                 

Gene name
deoA
Definition
thymidine phosphorylase DeoA (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:arr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283124..1284434
Genome map
AA seq 436 aa AA seqDB search
MTSTEAFDAVQIISIKRDKGTLTPEQIDWTIDAYTRGIIAEEQMAALNMAILLNGMDRAE
ISQWTSAMIASGERMDFSSLTRPDGGRKATSDKHSTGGVGDKITLPLAPLVAVFGVAVPQ
LSGRGLGHTGGTLDKLEAIPGWRANLSNDEIMAQLQDVGAVICAAGSGLAPADKKLYALR
DVTGTVEAIPLIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDEARARELAETMVALGKDA
GVHTVALITDMSTPLGLTAGNAIEVEESVEVLAGGGPEDVVELTVRLAEEMLAGAGIHDA
DPAAALKDGRAMDVWNRMIEAQGGDPRAALPVARESEVVYAPADGVLVGLDALSVGVAAW
RLGAGRARKEDQVQAGAGVRLHAKPGALVRAGEPLMTLLTDTPEKFERAKEALQDAVVIA
PEGSRPAHQLIIDRIA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcactgaagcgttcgacgccgtccagatcatttccatcaagcgggacaagggc
acgcttactcccgagcaaatcgactggaccatcgatgcctatacccgcggcatcatcgcc
gaggaacagatggccgcactgaacatggccatcctgctcaacggcatggaccgcgccgag
atttcgcagtggacgtccgcaatgatcgcctctggtgagcggatggacttttcgtccctg
acaaggcccgacggcggccggaaggctaccagcgacaagcactccaccggaggggtgggg
gataagatcacgctgccgttggcgccgctggtggctgtgttcggcgtcgcggttccgcag
ctgtcgggccgcggcctcggccacaccggcgggacgctggataagctggaagccattccc
ggttggcgcgccaacctgagcaacgacgaaatcatggcgcagctccaagacgtcggagcg
gtcatctgtgccgcaggctcagggctcgccccggcggacaagaaactctatgccttgcgc
gacgtgacaggcaccgttgaagccatcccgctgattgcttcgtcgatcatgagcaagaag
atcgccgaaggtaccggttcgctggttttggacgtcaaagtgggttcgggcgcgttcatg
aaggacgaagcacgggcacgtgagctggctgagaccatggtggctttgggcaaggatgca
ggcgtacacaccgtcgcgctgatcacggacatgtccacgccgcttggattgactgccggt
aacgccattgaggtggaggaatcagtggaggtccttgccggcggcggtccggaagacgtg
gtcgaactgaccgtccgcctggccgaggagatgctggccggtgccggcatccacgacgcc
gatcccgcagccgcgttgaaggacggacgcgccatggacgtctggaaccggatgatcgaa
gcccaaggtggagatccccgggccgcgctgcccgtggccagggaatccgaggttgtctac
gctccggcggacggcgtcctggtgggattggacgcactttccgtgggtgttgcggcttgg
cgcctgggtgccggccgggcacgcaaggaagaccaggtccaggccggggcgggtgtccga
ttgcacgccaagcctggtgcgctggtccgtgcgggggagcctttgatgaccctcctgacg
gacactccggagaagttcgaacgggcaaaggaagcacttcaggatgcggtggtgattgcg
cctgagggttcccgcccggcgcatcagctcatcatcgaccgcatcgcctag

DBGET integrated database retrieval system