KEGG   Arthrobacter sp. Rue61a: ARUE_c13110Help
Entry
ARUE_c13110       CDS       T02215                                 

Definition
bifunctional uroporphyrinogen-III synthase/response regulator domain protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:arr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1409440..1410597)
Genome map
AA seq 385 aa AA seqDB search
MTVARAIEVQDATAAPEVSEAVEAPLDGFRIGVTSHRRSRDLIEALERRGASVLHAPALK
IAPVQEDMVLIEDTRTIIAAKPDICIATTAYGMRRWCEAADSFGIGEQLLETLSACRMFV
RGPKARGAVRAAGLADVGISSDETTATLVDMLLAEGVRGKTVAVQLHGYTDVRQLERLRM
SGATVLTVTPYRWVKPDGEDKLPRLIEAVVSGNLDVLTFTSAPAVDAMWSTAHEMGLYRQ
LIEALKGPVTVAAVGPVTAQPLVDAGLTPLIPDRYRMGALIRLVTEHLSLNHVRRLETKS
ATIELRGRCLRINGEVVDLAPAPLLLLRALLGAGGAVLSREALSDLLDLRGSVHALDMTV
SRLRSSLPDGKLVETVVKRGYRLRA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgcacgtgccatcgaagtccaggacgctactgccgcaccggaagtttccgaa
gccgtagaagcgccgctggatggattccgcattggcgtcacctcgcaccgccgttcccgt
gacctcatcgaggcactggagcgccgcggtgcgagcgtgttgcacgcccccgccttgaag
atcgcccctgtgcaggaggacatggtcctcatcgaggacacgcgcaccatcatcgcggcc
aagcctgatatctgcatcgccactacggcctacgggatgcgtcgctggtgtgaggccgcc
gattcctttggcatcggcgagcaactcctggaaaccctgtccgcctgccgcatgttcgtc
cgtgggcccaaagcccgcggcgccgtgcgggcggccggtcttgccgacgtcggaatcagc
agtgacgaaaccaccgcgacgctggtggacatgctgctggccgaaggcgtgcgcggcaag
acggtggccgtgcaactgcacggatacacggatgtgcgccagctggaacggctccgcatg
tccggggccactgtccttacagtgactccgtaccgttgggtgaagcccgacggcgaagac
aaactgccgcgcctgatcgaagccgtggtcagcggcaacctcgatgtgttgacctttacc
agcgccccggccgtggacgcgatgtggagcactgcacacgaaatgggcctctaccgccag
ctcatcgaggccctcaagggtccggtgactgttgcggccgttgggccggtcactgcacag
ccgctggtcgacgccgggctgacgccactgattcccgaccgttaccgcatgggcgcgctc
atcaggctggtgacggaacatttgtccctcaaccatgtgcggcgtttggagaccaagagc
gccaccattgagttgcgtgggcgctgcttgcgtatcaacggtgaggtggtggacctcgca
ccggctcccctgctgctgctgcgagcgctgctcggcgcgggtggggctgtcctgtcccgg
gaagctctttctgacctgttggacctgcgcggttcggtgcacgccttggatatgacagtg
agcaggctgcggtcctctcttccggacggcaagctcgtggaaaccgtggtgaagcgcggt
taccggctgcgggcttag

DBGET integrated database retrieval system