KEGG   Arthrobacter sp. Rue61a: ARUE_c13820Help
Entry
ARUE_c13820       CDS       T02215                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c13820 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c13820 (glk)
   00052 Galactose metabolism
    ARUE_c13820 (glk)
   00500 Starch and sucrose metabolism
    ARUE_c13820 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c13820 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ARUE_c13820 (glk)
   00524 Butirosin and neomycin biosynthesis
    ARUE_c13820 (glk)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ARUE_c13820 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1509825..1510760
Genome map
AA seq 311 aa AA seqDB search
MVLGAAKSPVLSFDVGGTDIKAGLVDARGTVLGMRRVPTPLDPARPGEAVLDRLAELKAE
LASEFPEAPAKAAGIIVPGIVDSVAGVGIYSANLGWRNFPFKAEAEKRLGIPVAFDHDVR
SAAAVEHSFGGSKEFNDVVVMVVGTGIAAAVFSGGKAVTAGGFAGELGHAQVPDPDAAPG
ATGSTILEAVGSAGAIAKRYHRASGNTVDGARGVLLRAGAGDSVAARVWDDAVDALAFTI
CQCVNIIGTEAVVIGGGLAEAGDELLEPLRKRVDGILDFQRRPQLIRAQLGQDAGLLGAA
LNARAVLGGAQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggttctcggagccgcaaaatcaccggtcctgtcattcgacgttggcgggacggatatc
aaggctggtttggtggacgcccggggaactgtcctgggcatgcgccgcgtccctacgccg
ctggatccggcccgccccggcgaagcggtcctggacaggctcgctgagcttaaagcagag
ttggcctcggagtttccggaagcccccgccaaggcagcaggcatcattgtccccgggatc
gtggactccgtggccggagtgggtatctactccgccaacctcggatggcgtaacttcccg
ttcaaagccgaagccgaaaaacggctcggcatccccgtcgcgttcgatcacgacgtccgt
tccgctgcggctgtggaacacagcttcggcggttccaaagagttcaacgatgttgtggtg
atggtggtaggtaccggcatcgcagcagccgtgttctccggcggaaaggctgttaccgcc
ggcggtttcgccggcgaactcggccacgcccaggtaccggaccccgacgccgccccaggc
gccaccggctccaccatcctggaagcagtgggctcagccggggccattgccaagcggtac
caccgggcatcgggaaacacggtggacggtgcacgcggagtactgctcagggcaggggca
ggagactcagtcgctgcacgcgtttgggacgatgccgttgatgcccttgctttcaccatc
tgccaatgcgtgaacatcattggtactgaagccgtggtaatcggcggaggcctcgctgaa
gccggcgacgaactgctcgagccgctccgcaaacgggttgacgggatcctggactttcag
cgtcggccccaacttatccgtgcccagctgggacaggacgcaggcttgctcggtgcggcc
ctgaatgcccgggcagtgttaggaggcgcacaatga

DBGET integrated database retrieval system