KEGG   Arthrobacter sp. Rue61a: ARUE_c14560Help
Entry
ARUE_c14560       CDS       T02215                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase Dxr
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00900  Terpenoid backbone biosynthesis
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01130  Biosynthesis of antibiotics
Module
arr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ARUE_c14560 (dxr)
Enzymes [BR:arr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ARUE_c14560 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom CUE
Motif
Other DBs
NCBI-ProteinID: AFR28372
UniProt: J7LSH5
Position
1589301..1590485
Genome map
AA seq 394 aa AA seqDB search
MQPRKIVILGSTGSIGTQAIDVVDAAPHRFEVVALSAGGGNLALIAQQAVHTRAQAVGIA
QGDQGALRQLIAAAAAAAGVRNFAPEIFVGPDASTRIAAIECDVVLNGITGSIGLAPTLA
ALGTGATLALANKESLIVGGALVKAAASPGQIVPVDSEHSAIAQCLRSGTDQEVEKLILT
ASGGPFRGRSREQLHDVTPQEALAHPTWDMGLMVTTNSASLVNKGLEVIEAHLLFDVPLD
RIDVVVHPQSVVHSMVQFVDGSIIAQASPPDMRLPIALGLGWPDRVPRAAQACDWTQATS
WTFEPLDTVAFPAVDLAKDAAKQGSTFPAVFNAANEEAVEAFHAGRIRFTQIVDTVESVL
SEHSGSSELTVESVLDAEKWARARTLDRLASSAL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcgcaagatcgtcatcctcgggtccaccggttccatcggcacacaagcgatt
gatgtcgtcgacgccgccccacaccgttttgaggtggttgcgctcagcgcgggcggagga
aaccttgcactcatcgcgcaacaggccgttcacacgcgggcgcaagccgtgggtatcgcc
caaggagatcagggagccctgcggcaattgatcgcggccgctgccgctgcagcaggcgtg
cgaaacttcgctccggagatttttgttgggccggacgcctccacccggatcgccgccatt
gagtgcgacgtcgtcctcaacggcatcaccggttccatcggattggcgcccaccttggcc
gcgctcggtacgggagccacgctggcactggccaacaaggagtcgctgatagtcggcggc
gccctggtcaaagctgctgcgagccccggccagatcgtccccgttgattcagagcactcc
gccattgcccagtgcttgcgttcaggaacggaccaggaagtcgaaaagctgatcctgacg
gcatccggcgggcccttccgcggacgctcacgggaacagctccacgacgtcacgccgcag
gaggcgctggctcaccccacctgggacatgggcctcatggtcaccacaaactcggccagc
ctggtcaacaagggcctcgaagtgattgaggcacacctgctgttcgacgttcccctggat
aggatcgacgtcgtggttcatccgcagtccgtggtccattccatggtccagttcgtggac
ggatccatcattgcccaggcgtcacccccggacatgcggttgccgatcgcgctcgggctg
ggttggccggaccgcgtccctcgcgctgcacaggcatgcgactggacgcaagccaccagc
tggaccttcgaacccttggatactgtggcgttcccggccgtggacctcgccaaggacgcc
gcgaagcagggcagcacgttcccggcagtgttcaacgccgccaatgaggaagccgtagag
gccttccacgccgggcgcatccgcttcacccagattgtggatacggttgagtccgtcctc
agcgaacattcaggctcctctgagctaacagtggagtccgtgcttgatgctgagaagtgg
gcacgcgcccgtacccttgatcgtttagccagcagcgccctgtag

DBGET integrated database retrieval system