KEGG   Arthrobacter sp. Rue61a: ARUE_c15980Help
Entry
ARUE_c15980       CDS       T02215                                 

Gene name
glkA
Definition
(GenBank) glucokinase GlkA
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00010  Glycolysis / Gluconeogenesis
arr00052  Galactose metabolism
arr00500  Starch and sucrose metabolism
arr00520  Amino sugar and nucleotide sugar metabolism
arr00521  Streptomycin biosynthesis
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01130  Biosynthesis of antibiotics
arr01200  Carbon metabolism
Module
arr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c15980 (glkA)
   00052 Galactose metabolism
    ARUE_c15980 (glkA)
   00500 Starch and sucrose metabolism
    ARUE_c15980 (glkA)
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c15980 (glkA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ARUE_c15980 (glkA)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARUE_c15980 (glkA)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ARUE_c15980 (glkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Hydant_A_N DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AFR28510
UniProt: J7LME7
Position
1744403..1745461
Genome map
AA seq 352 aa AA seqDB search
MPALRSSSLVRTKPPASAWKEVPWAARRSHLGRRGLAIGIDIGGTKVAAGVVDADGRVLA
EARRSTPGADPRAVEQTIVELVDELSAGHRIASVGIGAAGWMDLDGGTVLFSPHLAWRNE
PLRESLQKLLRRPVLLTNDADAAAWAEWRFGAGQGESRLVCITLGTGIGGAMVMDGRVER
GRFGVAGEFGHQIIFPGGHRCECGNRGCWEQYASGNALGREARQLVRTNSPAGRALLEKA
GGTAEKLSGAAVTSLALAGDATSRELLADQGDWLGLGLANLAAALDPGMFVIGGGLCDAG
ELLAAPARESFAKNLTGRGFRPMARIELAALGPRAGMIGAADLSRVSGRARS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcactacggtccagttccctggtcagaaccaagccaccggcctctgcctggaag
gaggtcccgtgggctgcccgccgcagccatttgggccgcaggggcctggcaatagggatc
gacatcggcggcaccaaagtggccgccggtgtggtggatgccgacgggcgggtcctcgcc
gaggcccgcaggtccacacccggtgccgaccccagggctgtcgagcagaccatcgtggaa
ctcgtggacgagctgagcgcaggacaccgcatcgcatcggtagggattggtgccgcagga
tggatggacctcgacggcggcacggtcctgttcagcccacaccttgcctggcgtaacgag
cccctgagggagagcctgcagaagttactgaggcgtcccgtgctgctcaccaatgacgcc
gatgccgcggcctgggcggagtggcgctttggcgcaggacagggtgaaagccgcctggtc
tgcatcacactgggcacgggcataggcggcgccatggtcatggatggccgggtggagcgg
ggacgctttggcgtcgccggggagttcgggcaccagatcatctttcccggtggacaccgt
tgcgaatgcggtaaccgcgggtgctgggagcagtacgcctccggcaatgcgctggggcgt
gaagcccggcagttggtgcggaccaattccccggctggccgcgctttgctggagaaggca
ggcgggaccgcggagaaactgtccggggcggccgtgacctcgctggcgcttgcgggagat
gccacctcccgtgaactccttgccgaccaaggtgactggttggggctggggttggccaac
ctcgcagcggcattggaccctggaatgttcgtgatcggcgggggcctgtgtgatgcgggg
gagttgctcgccgcaccagcacgggagtcgttcgccaagaacctgacgggcagggggttc
cgtcccatggcgaggatagaactcgcggccttgggcccgcgagccggcatgatcggcgcc
gccgacctttcacgggtcagcggccgggcgcgcagctga

DBGET integrated database retrieval system