KEGG   Arthrobacter sp. Rue61a: ARUE_c16010Help
Entry
ARUE_c16010       CDS       T02215                                 

Definition
esterase/lipase, alpha/beta-hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Brite
Enzymes [BR:arr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     ARUE_c16010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1746832..1747620)
Genome map
AA seq 262 aa AA seqDB search
MTERLIPAAPLAFHHAGHGANASIGVAICHGFTGSPLSVLPWAEYLAKQGFAVSVPLLPG
HGTSWQDLATTRWQDWYRTFERSYLDLAANTGTCFVAGLSMGGAVALRVASRHEVPGLVL
VNPGLSFYDRRVRYVGALKYVMRTTTPIVEDTPTPVTTEDGDYSKTPLKSVHELKKLFRA
ATRGLPHVEAPALVFKSSVDDVIPPSSVATISKSIGSSRLKVVALPHSGHVATLDVDAPT
IFEESAGFFRQHAGDRVASESS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacgccttatacccgccgcgccgctcgcattccaccatgccggacacggagcc
aacgcatccataggagtggccatctgccacggcttcaccggaagccccctcagcgtcctc
ccctgggccgagtatctcgcaaagcagggctttgcggtgtccgtgcccctgctccccgga
cacggcaccagctggcaggacctcgccactacaaggtggcaggactggtaccggaccttc
gagaggagctacctggatctggcggcgaacaccggaacgtgttttgtggcaggcctgtcc
atgggcggagccgtggctctgcgggtggcctcccgccatgaagttcccgggctggtcctg
gtgaacccggggctgagcttctatgaccgccgcgtgaggtatgtcggagcgctgaagtac
gtcatgcgcaccaccacccccatagtggaggacactcccacgccggtaacaaccgaggac
ggagactactccaagacaccgctgaagtctgtccacgaactcaagaaactcttccgcgct
gctacccggggcctcccgcacgttgaggctccggccctggtcttcaaatcctcggttgac
gacgtcatccctccgagctctgtggccactatcagtaagtcaatcggctcttcccgcctg
aaagtagtggcgcttccgcacagcgggcacgtagccaccctggatgtggatgcacccacc
atttttgaagaatcagccggctttttccgccagcatgccggggacagagtagcctcagag
tcatcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system