KEGG   Arthrobacter sp. Rue61a: ARUE_c16160Help
Entry
ARUE_c16160       CDS       T02215                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase MurE (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:arr00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:arr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1762625..1764271
Genome map
AA seq 548 aa AA seqDB search
MSEHNEAAINATMPDAGQTGFRPASVAAVPLATIADALGVAAPDASQDRGVTGITLNSRA
VETGDLYMALPGASRHGADFVPQAVEAGAVAVVTDDAGARQLALAGEQPVPVLIVPEPRT
AVGRLAALIYRSQPADGGFPTLYGVTGTNGKTTTTYFINSLLRALEKKPGLIGTIEIVAG
GDPIPSLLTTPESTDVHALLALMRERGLDAASMEVSSHAISYHRVDGVMFDVAGFTNLTQ
DHLDLHGSMDEYFRTKAELFTAGRARHAVVTVDDDWGRQLAETADIPVTTLSTKPVDGSS
SSTDWKVASITARGLGSEFELKHADGRTLRVHTGLPGDFNVANAALATVMVLASGVDEHT
LQAALDAHDPFTVSVPGRMQLISTEPASVVDFAHNPDALSRALEAVRSPREGSRVIVVFG
ATGQRDQGKRPTMGAIAARLADVVIISDDDPHDEDAAAIRAEVLQGAHAARDSENLNSEI
IESYPRDAAIKLAVDMATGKDTILIAGRGHEVWQEVKGVNLALDDRVELRAALTSKGFSV
SADQRIES
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagcacaatgaggcagctatcaacgccacgatgccggatgccggccaaacaggc
tttcgtcccgcatccgtggccgcggtgccgttggcaaccatcgcggacgcactcggtgtt
gccgctccggacgccagccaggacaggggagtgacggggattaccctgaactccagggcc
gtcgaaacgggcgacctctacatggctttgccgggagcctcccgtcatggtgccgacttc
gttccccaggcagtcgaggccggggcggttgcggttgtcacggacgacgccggggcccgc
cagcttgcgcttgcaggtgagcagcctgtgccggtacttatcgtccctgagccgcgaacc
gccgtcggacgtcttgccgcactgatctatcgcagccagcctgcggatggtggcttcccg
acgctgtacggcgtcaccggtaccaacggcaagaccaccaccacctacttcatcaactcc
ttgctgcgtgccttggagaagaagcccggcctcatcggaaccatcgaaatcgttgcagga
ggcgatccgatccccagcctcctgaccacgccggaatccaccgacgtccatgcactgctg
gccttgatgcgcgaacgaggcctggacgcggcatccatggaggtctcgtcccacgccatc
tcctaccaccgcgtggacggagtgatgttcgacgtcgccggttttaccaacctcacccag
gatcatctggacctgcacggaagtatggacgagtacttccgcaccaaggctgagctcttc
acagctggaagggccaggcacgcagtggtcacggtggacgacgactggggacgccagctg
gctgagacagccgatattccggtcaccacactctccaccaagcctgttgatggaagcagc
tccagcaccgactggaaggttgcgtccatcacggcgcgcggactgggctcggaattcgaa
ctcaagcacgctgacggacgaaccctgcgcgtccacaccggcctgccgggagacttcaat
gtggccaacgcggccctggccacagtgatggtccttgcatccggcgtggacgaacacacg
ctccaggctgccctggatgcgcacgatcccttcacagtgtcagtgcccggacgaatgcag
ctcatctctactgagcctgcctccgttgttgattttgcccacaaccctgacgccttgtcc
cgtgccttggaagccgttcgctcaccccgggaggggtcccgcgtcatcgtggtcttcggg
gcaacaggccaacgcgaccaaggcaagcgccccaccatgggagccatcgctgcccgcctc
gcagacgtcgtgatcatcagcgatgacgatccccacgacgaagacgctgcagcaatccgg
gctgaggtcctccaaggcgcccatgcggcccgggattcagagaatctgaacagcgaaatc
atcgagtcctacccgagggatgccgccattaaattggccgtcgacatggcaaccggcaag
gacaccatcctgatcgccgggcgtggacatgaggtgtggcaagaggtcaagggagtgaac
ctggccctggacgacagggtggagttgcgggccgccttgacatccaagggattcagcgtt
tcagcggaccagcggatagagtcctaa

DBGET integrated database retrieval system