KEGG   Arthrobacter sp. Rue61a: ARUE_c16350Help
Entry
ARUE_c16350       CDS       T02215                                 

Gene name
hisD
Definition
histidinol dehydrogenase HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:arr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:arr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1784423..1785787
Genome map
AA seq 454 aa AA seqDB search
MTTSSDTSAPTTDALNFRSIDFRGRHLSLAELRAAVPRAQHQTMADAEQKVLDIIADVRS
RGFAALGELAKKFDGVVQSHPRVPAEALTQALTDLDPKVRAALEESIKRARQFADQQRPA
NVDVQLGDGAVVSQNWIPVGRVGLYVPGGLAPLASSVIMNVVPAVAAGVESIALASPPQK
DFGGLPHPTILAAAKLLGIDEVYAIGGAQAIVSFAYGIPGTDDELPLEPVDVVTGPGNIF
VATAKRLVKGVVGIDSEAGTTEIAILADSTAQAPLVAADLISQAEHDPKAASVLVTDSAE
LADAVVLELSRQAAATKHSARVLEALSGPQSGAVLVDDLEQGIAVCNAYAAEHLEIMTAN
APTVASRIRNAGAIFVGDFSPVSLGDYCAGSNHVLPTSGTAAFSSGLNVTTFLRAVQVIN
YDRAALEQVSGHIVSLSGAEDLPGHGDAVRIRFA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacttcctcggatacttccgcccccaccactgacgccctgaacttccgaagcatc
gacttccggggccgccacctttcgttggcggaacttcgcgcagctgtgccaagggcgcag
catcagacaatggcggacgcggagcagaaggtcttggacatcattgccgatgtccgcagc
cggggcttcgccgccttgggtgagctggcaaagaagttcgacggcgtggtgcagtcccac
ccccgggttccggcggaggccctcacccaagcgctgaccgatctcgatccgaaggtccgt
gcagccctggaggagtccatcaagcgcgcccgccagtttgctgaccagcagcggcccgcc
aatgtggatgtacaacttggcgacggcgccgtcgtcagccaaaactggataccagtggga
cgcgttgggctctacgttcccggcggactcgcccctttggcgtcatcagtcatcatgaat
gtcgtccccgcagttgccgccggcgttgagtccattgcactggcctctcctccgcagaaa
gacttcggtggcctacctcaccccaccatcctggccgcagcgaagctgttgggcatcgac
gaggtgtacgccatcggtggtgcgcaggccattgtgtcgtttgcctacggaatcccggga
accgacgatgaactgccccttgagcctgttgacgtggttacaggccccggaaacattttt
gtggccacagccaaacgactcgtcaagggtgtggtgggcatcgactccgaggctggaacc
actgagatcgccatcctcgccgactccacggcgcaggccccgttggtggccgccgacctc
atcagccaggcggagcacgatcccaaagcagcttccgtcctggtgacggactccgcggaa
ctggctgacgccgtcgtgcttgaactgtcacggcaggccgctgcaacaaagcacagtgcc
cgcgtccttgaggcgctgtccggaccacagtccggtgcggtgctggtggatgatcttgag
caggggatcgcggtttgcaatgcctacgccgctgaacacctggagatcatgacggcgaac
gcacccactgttgcatcgcggatccgcaacgcgggcgcgatcttcgtgggcgacttcagc
ccggtgagcctgggggactactgcgcaggttccaaccacgtgctgcccaccagcggaacc
gcggcattctcttcgggcctcaacgtcaccacgttcctccgggcagtccaggtcatcaac
tatgaccgcgctgcgttggagcaagtcagcggacacattgtgagcctgtcgggcgccgaa
gacctgccgggtcacggtgacgctgtccgaattcgcttcgcttag

DBGET integrated database retrieval system