KEGG   Arthrobacter sp. Rue61a: ARUE_c16590Help
Entry
ARUE_c16590       CDS       T02215                                 

Gene name
dltA
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c16590 (dltA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARUE_c16590 (dltA)
  Amino acid metabolism
   00310 Lysine degradation
    ARUE_c16590 (dltA)
Enzymes [BR:arr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ARUE_c16590 (dltA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1810579..1812312)
Genome map
AA seq 577 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEIDEPLLEVSTDKVDTEIPSPISGVIEEIL
VAEDETAEVGAPLVRIGDGSGSAAPAAEAAPAEEAPAEQAAPAEEAPAAPAAEEAPAAEA
PAASGEGHEVTLPALGESVTEGTVTRWLKAVGDTVEVDEPLLEVSTDKVDTEIPSPVAGT
LQEIRVSEDETAEVGSVLAVIGSGAAAPASAPAPAAPAAEAPAAPAAAPAPAAAPAAPAA
APAPAAPAAAPAPAAAPAAPAAEGSSESGYVTPLVRKLANQHGVDIASVSGTGVGGRIRK
QDVLAAAEAKQAAAAPAAAAPAAAPAAKAAAPVVASSLRGTTEKAPRIRQVIARRMRESL
EVSTQLTQVHEVDMTKIAKLRLKAKNSFQAQNGVKLTFLPFIAKAVAEALKQHPKLNAAY
DESKQEITYHNAEHLAIAVDTDKGLLVPVISDAGNLNLAGLAGKIADVAGRTRDGKIGPD
ELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRAVVVADENGDDSIAIRSMMY
LSLTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagtgtcaccgaaggaaccgtcacc
cgctggctcaagcaggttggtgaccgggtagagatcgacgagccgttgctcgaggtttca
accgacaaagtagacaccgaaatcccttctccgatctcaggcgtcatcgaagaaatcctc
gtcgctgaagacgagacggccgaagtgggcgcccccttggtccgcatcggcgacggctcc
ggttcagctgctccggcagctgaggccgcaccggctgaggaagcccctgcagagcaggct
gcaccggccgaggaagctcctgccgcccccgccgctgaagaagcaccagcagctgaagca
cccgccgcttcgggtgaaggccacgaagtgaccctcccggcattgggcgagagcgtcacc
gaaggtactgtcacccgctggctcaaggccgttggcgacaccgtggaggtcgacgaaccg
ctcctcgaggtctccaccgacaaggtagacaccgaaattccttccccggttgccggcacc
ctgcaggaaatccgtgtcagcgaggacgagacagcagaggttggctccgtcctggccgtc
atcggttccggcgcagctgcgcctgcatctgctcccgctccggctgcacctgcggctgag
gcaccggccgctcccgctgctgcacccgccccggctgctgctccggctgctccggctgct
gcacccgccccggccgctccggcagccgcgcctgctcccgccgcagctccggctgctccc
gcggctgaaggttcttcggaatccggctacgtcactcccctggtccgtaagcttgccaac
cagcacggcgtggacatcgcttcggtctccggcaccggcgtcggtggccgcatccgtaag
caggatgttctggctgctgcggaagcaaagcaggcagccgcagcccccgctgcagctgct
ccggccgcagcaccggcagccaaggccgctgcccccgtggtcgcatcctccttgcgtggc
accactgagaaggccccgcgtatccgtcaggtcattgcccgccgcatgcgcgagtccctt
gaggtctccactcagctgacacaggtgcacgaggtcgacatgaccaagatcgccaagctc
cgcctcaaggccaagaactcgttccaggcccagaacggcgtcaagctgaccttcctgccg
ttcatcgccaaggctgtggccgaggccctgaagcagcaccccaagctgaacgctgcttac
gacgagtcgaagcaggaaatcacctaccacaacgccgaacacctggcgatcgccgtcgac
actgacaaaggcctactggttcccgtcatttccgacgccggcaacctgaacctcgccggc
ctggccggcaagatcgccgatgtcgcaggccgtacccgcgatggcaagatcggcccggac
gaactgtccggtggcacgttcagcatcaccaacatcggctccgttggtgcactgtttgat
accccgatcatcaaccagccgcaggtaggcattctcggaaccggtgcgatcgtcaagcgc
gccgtcgtggttgccgacgaaaacggtgacgactcgatcgccatccgctccatgatgtac
ctgtccctcacgtacgaccaccgcctggtggacggtgctgatgccggacgcttcctgcag
accctcaaggcccgccttgaagaaggcgctttcgaagcagacctcggtctctaa

DBGET integrated database retrieval system