KEGG   Arthrobacter sp. Rue61a: ARUE_c17420Help
Entry
ARUE_c17420       CDS       T02215                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARUE_c17420 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARUE_c17420 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARUE_c17420 (trpB)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARUE_c17420 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1896995..1898371
Genome map
AA seq 458 aa AA seqDB search
MVDAPTAGSEENAADAFLQGGPSLRNASGPYFGSYGGRWMPESLIAALDEVQDTFEKAKA
DPDFIAQLKDLNKNYSGRPSLLTEAKRFSEHAGGARIFLKREDLNHTGSHKINNVLGQAL
LAKRMGKTRVIAETGAGQHGVASATAAALLGLECVVYMGAEDCRRQALNVARMQLLGATV
VPVTNGSQTLKDAINDALRDWVSNVEHTHYLLGTAAGAHPFPAMVRYFHEVIGEEARSQI
LEQTGKLPDAIAACIGGGSNAIGLFHAFLDDASVKIYGFEAGGEGVETGRHAAAISLGRP
GVLHGARSYLMQDEDGQTIESHSISAGLDYPSVGPEHSYLADIGRVTYEAVTDTEAMDAF
SLLCRTEGIIPAIESSHALAGAIKIGKRLTEGKETPSDVTVIVNLSGRGDKDVETAAAWF
NMLDEEGHVKGTTLSTRKPKGPTEHTSEAAVDVNEDQK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgcgccaacagccggctcagaagagaatgcggcggacgcattcctccaaggt
ggcccttcgctgcggaatgcatcggggccctactttggcagctatggcggacgctggatg
cccgagtcgctcatcgccgcccttgacgaagtccaagacacttttgagaaagccaaagct
gatcccgatttcatcgctcagctgaaggacctcaacaagaactactcaggcaggccttcc
ttgctgaccgaagccaagcgcttctcggagcacgccgggggagcacgtattttcctcaag
cgcgaggacctcaaccacactggctcccacaagatcaacaacgtcctgggccaggcactc
ctcgcgaagcgcatgggcaagacccgcgttatcgctgagaccggtgccggtcagcacggc
gttgcgagtgccacggccgcagccctgctgggcctcgagtgcgtggtgtacatgggtgcg
gaggattgccgtcggcaggccttgaacgtggcccgcatgcagctgctgggcgccacggtt
gttccggtaaccaatggttcacagacgctcaaggacgccattaacgatgcccttagggat
tgggtctccaacgtggagcacacccactaccttctgggcacagcagccggtgcgcacccc
ttccccgccatggtccgctacttccacgaagttatcggcgaagaagcgcgcagccagatc
ctggagcaaaccggcaagctccctgacgccattgctgcatgtatcggtggcggctccaac
gccattggtttgttccacgctttccttgatgacgcttccgtgaagatctacggctttgaa
gccggcggcgaaggtgtggaaacgggccgccacgcggctgccatttccctgggccgtcca
ggcgtactgcacggtgcccgctcctacctcatgcaggacgaggacggccagaccatcgag
tcccactccatttcggccggcttggactacccgagcgttggtccggagcactcgtacctg
gccgacatcgggcgcgtgacctatgaggccgttaccgacacagaggccatggatgccttc
agcctcctctgccggaccgagggcatcattcccgccattgagtcctcgcacgccctggcc
ggtgccatcaagatcggcaagcggctcacggagggcaaggaaactccctcggacgtgacg
gtgatcgtcaatctgtccggacgcggtgacaaggacgtggagactgccgctgcctggttc
aacatgttggacgaggaagggcacgtcaagggcactacgctgtccacgcgaaagcccaag
gggccaactgagcacacgtccgaagcagccgtggatgtcaacgaggaccagaagtga

DBGET integrated database retrieval system