KEGG   Arthrobacter sp. Rue61a: ARUE_c17430Help
Entry
ARUE_c17430       CDS       T02215                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARUE_c17430 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARUE_c17430 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARUE_c17430 (trpA)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARUE_c17430 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1898368..1899183
Genome map
AA seq 271 aa AA seqDB search
MMTEEFASKSAGAIDRAKADGRAALVGYLPAGYPTVQESIEAGIALARNGADLIEIGIPY
SDPVMDGPVIQAATTEAISNGFRVSNVFDVVAGITAATDAAVLVMTYWNPVMRMGVDEFS
RRLAEAGGAGLITPDLVPDEAHEWFEASDKYGLDRVFLVAPSSTPERLDMTVKASRGFVY
AVSIMGVTGTRTSVSSSAEDVVARAHAAGAERVCVGLGVSNPDHVREIAAYADGVIVGTA
LVAALRDGGVDAVGQLTKNLSAGLGRAAAEA
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgatgactgaagaattcgccagcaaatccgcaggcgccattgaccgcgcaaaagcagac
ggccgcgccgcgctggtgggctacctccccgcgggctacccgacggttcaggagagcatc
gaggccggcatagccttggcccgcaacggtgctgacctcatcgaaatcggcattccgtat
tccgatcccgtgatggacggccctgtcatccaggccgctaccaccgaagcgatttccaac
ggattccgggtgtccaacgtctttgacgtggttgccggcattaccgcagctactgatgcg
gccgttctggtcatgacgtactggaaccctgtcatgcgcatgggcgtggatgagttttct
cgccgtttggccgaggccgggggagcagggctcatcactccggacctggtcccggacgag
gctcatgagtggttcgaagcctcagataagtacggcttggaccgggtgttccttgtggcg
ccctcgtccactccggagcgactggacatgacggtcaaggcaagccgcggcttcgtctac
gctgtctcgatcatgggtgtcaccggaacgcgcacctccgtcagcagcagcgctgaagac
gtagtggcccgcgcccatgcggccggtgccgaacgcgtttgcgtggggttgggcgtctcc
aacccggatcacgtccgcgaaatcgctgcctatgcggacggcgtgatcgtgggtacggct
ttggtggcggccctccgcgatggcggcgtggacgccgtcggacaactcaccaagaacctc
agcgccggcttgggccgcgcagctgcagaagcctag

DBGET integrated database retrieval system