KEGG   Arthrobacter sp. Rue61a: ARUE_c18620Help
Entry
ARUE_c18620       CDS       T02215                                 

Gene name
tpiA2
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c18620 (tpiA2)
   01230 Biosynthesis of amino acids
    ARUE_c18620 (tpiA2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c18620 (tpiA2)
   00051 Fructose and mannose metabolism
    ARUE_c18620 (tpiA2)
   00562 Inositol phosphate metabolism
    ARUE_c18620 (tpiA2)
Enzymes [BR:arr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARUE_c18620 (tpiA2)
Exosome [BR:arr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARUE_c18620 (tpiA2)
  Exosomal proteins of bladder cancer cells
   ARUE_c18620 (tpiA2)
  Exosomal proteins of melanoma cells
   ARUE_c18620 (tpiA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2050105..2050878)
Genome map
AA seq 257 aa AA seqDB search
MIGVSLKLYFGYQRSVDYCRDIATIALNHPAVVSGAIELFVLPILPVLPEAARILGTAGV
GTGAQDIFWEDEGAYTGEVGGKTVAELGGRYVEVGHAERRRIFGEDHRIIGLKTAAAYRN
GLTPVLCVGELNVGSPEEAIAQCTADIDAALNLAGTHGPTARTIVAYEPQWAIGAPEPAT
PEYISAVVHGLDEHLRSSPGQENSRVIYGGSAGPGLITELDTAVAGLFLGRFAHDPAALK
TILDETAARLAAKAVPA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggtgtgagcctgaagttgtacttcggctaccagcgttccgtggactactgccgc
gacatcgccaccatcgccttgaaccaccctgcagtggtgagcggcgccatcgaactgttc
gtgctacccatacttccggtgttgcccgaagcggcccggatcctgggcacggccggggtt
ggtaccggagcgcaggacatcttctgggaagacgaaggcgcgtacaccggcgaagttggc
ggcaaaaccgttgccgagctcggtggacggtatgtggaggtggggcacgcggagcgccgc
cggatcttcggcgaagaccaccggatcatcggactcaagacggccgcggcctaccgcaac
ggtctgaccccggtgctgtgcgttggcgaactgaacgtcggctcccccgaggaagcaatc
gcccaatgcacagccgacattgacgccgccctcaaccttgccggaacgcacggtcccaca
gcccggaccatcgtggcctacgagccccaatgggccattggcgccccggaaccggcaacc
ccggaatacatcagcgccgtggtccacggcctggacgagcacctgcggtcgtcgccgggc
caggaaaacagccgcgtcatctacggcggaagcgccggaccgggcctcatcacggaactg
gacaccgccgtcgcaggcttgttcctgggccgcttcgcgcacgaccccgcagcgctgaaa
accatcctggacgaaaccgctgcacgcctcgccgcgaaggcggtgccagcatga

DBGET integrated database retrieval system