KEGG   Arthrobacter sp. Rue61a: ARUE_c19430Help
Entry
ARUE_c19430       CDS       T02215                                 

Gene name
adhA1
Definition
alcohol dehydrogenase AdhA (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ARUE_c19430 (adhA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c19430 (adhA1)
  Lipid metabolism
   00071 Fatty acid degradation
    ARUE_c19430 (adhA1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    ARUE_c19430 (adhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ARUE_c19430 (adhA1)
   00626 Naphthalene degradation
    ARUE_c19430 (adhA1)
Enzymes [BR:arr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ARUE_c19430 (adhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2129361..2130374)
Genome map
AA seq 337 aa AA seqDB search
MANMMKAWWVGRPGSTSTHPLEQGTKHVPIPDKGELLVKVNVCGVCRTDLHLAEGDLPPR
HSWIVPGHEAVGIVVESGAGTGRFEAGDRVGVAWLGSTCGTCRYCQRGAENLCSRPVFTG
WDRDGGFAEMMTVREDFAYAIPPQFSDEEAAPLLCSGIIGYRALKRAALPPGGRLGIYGF
GGSAHLTAQIAIHSGASVFVMTRSEEAQVLARNLGAEYVGGAFDAPPVKLDSAILFAPVG
DLVPIAMRALDRGGTLAVAGIHLSDIPSMSYADELFYEKQVRSVTANTRGDGTELLALAA
DMPLIPTTTAYAFAAADQALDDLANDRITGAAVLRIS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacatgatgaaggcgtggtgggtgggaaggccaggaagcacttcgactcatccg
ctagagcaagggaccaagcacgtgccgatacctgacaagggcgaattgctggtcaaagtc
aacgtgtgtggagtctgccgcacggacctgcatctggctgaaggtgacctccctccgcgc
cattcctggattgttccaggtcatgaagctgtgggaatcgtcgtggaatcaggcgctggc
acgggtaggtttgaagccggcgacagggtgggtgtcgcatggctcggcagcacatgcggt
acttgccgctattgtcagcgcggcgccgaaaacctgtgcagcagaccggttttcacgggc
tgggaccgtgacggcggctttgcggaaatgatgacagtcagagaggactttgcctacgct
attcctccccaattcagcgatgaggaggcggcgccgctcctttgctccggaataattggc
taccgcgccctgaagcgggctgcccttccccccggcggccgcttgggcatctacgggttc
ggaggctcagcccacctgaccgcgcaaatcgcaatccattcaggcgcgtcggtcttcgtc
atgacacgatcggaggaggcgcaggttttggcccggaacctgggggcagaatacgtcggc
ggtgcattcgacgctccccccgtgaagctggactcagccattctcttcgcaccggtcggt
gacctggttccaatcgcgatgagggcgttggacaggggcggaactctggcggttgccggc
atccatctctccgacatcccctcgatgagctatgccgacgagctcttctacgagaagcaa
gtccgcagcgtcaccgccaacacgaggggtgacggaacggaattgcttgcgctcgcagcg
gacatgccattgattcccaccaccacggcatatgccttcgcagcagctgaccaggcattg
gacgacctcgcgaatgacagaatcactggagctgctgtgttgaggatttcatga

DBGET integrated database retrieval system