KEGG   Arthrobacter sp. Rue61a: ARUE_c22470Help
Entry
ARUE_c22470       CDS       T02215                                 

Gene name
tpiA3
Definition
(RefSeq) triosephosphate isomerase TpiA (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c22470 (tpiA3)
   01230 Biosynthesis of amino acids
    ARUE_c22470 (tpiA3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c22470 (tpiA3)
   00051 Fructose and mannose metabolism
    ARUE_c22470 (tpiA3)
   00562 Inositol phosphate metabolism
    ARUE_c22470 (tpiA3)
Enzymes [BR:arr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARUE_c22470 (tpiA3)
Exosome [BR:arr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARUE_c22470 (tpiA3)
  Exosomal proteins of bladder cancer cells
   ARUE_c22470 (tpiA3)
  Exosomal proteins of melanoma cells
   ARUE_c22470 (tpiA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2481028..2481843
Genome map
AA seq 271 aa AA seqDB search
MTTSANGNFIRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYNRAEVAVFPPFTDL
RGVQTLVQGDELEIVYGGQDLSQFDSGAYTGDISGQFLSKLGCAYVLVGHSERRTIHNES
DEVLNAKVKAAFRHGLTPVLCVGEGLEVRQAGTHVEHTLAQLRAGVEGLTAEQAAELVVA
YEPVWAIGTGEVAGPEDAQEMCAAIRAELAELFDETVAGKTRLLYGGSVKANNAAAIMAE
SDVDGLLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgactacctctgctaacggcaacttcatccgcaagcccttcatcgccggcaactggaag
atgaacatggaccacgtccagggcatcaccttgctgcagaagctcgcgtggacactgtca
gacgccaagcacgactacaaccgtgcggaggttgcagtattccctccgttcaccgacctc
cgcggtgtccagacactcgtacagggtgatgaactggaaattgtctacggtggccaggat
ctgtcccagttcgactccggcgcttacacgggtgatatctccggtcagttcctcagcaag
ttgggctgtgcctacgtattggtgggccacagtgagcgccgcactatccacaacgagtct
gacgaggttttgaacgccaaggtcaaggccgccttccgccatggacttactcccgtactg
tgcgtaggtgagggccttgaagtccgtcaggccggcacacacgttgaacacaccttggcc
cagctgcgtgccggtgtggaaggcctcacggctgagcaagctgctgaactcgttgtggct
tacgaacccgtctgggccatcggtaccggcgaagttgctggcccggaagacgcacaggaa
atgtgcgctgcaatccgcgccgagcttgccgaactcttcgatgagactgtcgcagggaag
acgcgcctcctttatggcggctccgtcaaggccaataatgctgccgccatcatggccgaa
agcgacgttgacggattgctcgtgggtggcgccagcctggaccccgccgagtttgctaac
attgtcaggttcgagagccacctcgtcacggactag

DBGET integrated database retrieval system