KEGG   Arthrobacter sp. Rue61a: ARUE_c24020Help
Entry
ARUE_c24020       CDS       T02215                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARUE_c24020 (glpK)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ARUE_c24020 (glpK)
Exosome [BR:arr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARUE_c24020 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2652829..2654217)
Genome map
AA seq 462 aa AA seqDB search
MGGAQPRRDLEQHPEVIGSALSKANLTRHDIAAVGITNQRETAVVWDKNTGEAVYNAIVW
QDTRTQSIVDELAQDGGPERFKQKVGLPLATYFSGTKIKWILDNVDGARERAEAGDLLFG
NTDAWVLWNLTGGVDGGVHVTDVTNASRTLFMDLETLQWDQEILDIFGVPASMMPAIKSS
SEVYGHVHTSQLLRETPVAGILGDQQAATFGQAAFQPGEAKNTYGTGCFLIFNTGEEIVH
SKNGLLTTLGYKLGDAKPHYALEGSIAVTGSLIQWLRDNLGMISSAPEVEELAAGVKDNG
GVYIVPAFSGLFAPYWRADARGAIVGLTRFANKGHIARAALEATAFQTREVLDAVNADSG
VPLTELKVDGGMVANEALMQFQADILGVPVVRPKVVETTALGAAYAAGLAVGFWKDLGEL
SANWNEDKRWEPQLPAEEQERQLRLWKKAVTKSMDWVDEDVK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgggtggagcacaaccccgccgagatctggaacaacaccctgaggtcatcggctcggcc
ctgtcgaaggccaacctgacacggcacgacattgccgccgtcggaatcaccaaccagcgc
gaaacagctgtcgtctgggacaagaacaccggcgaggccgtctacaacgccatcgtttgg
caagacacccgcacccagtcaatcgtcgatgagctggcccaggacggtggaccggagcgc
ttcaaacagaaggtcggcctgcccctggccacctacttctccggcaccaagatcaaatgg
atcctggataacgttgacggcgcccgcgaacgcgcagaagccggcgacctcctgttcgga
aacaccgacgcctgggttctgtggaacctgaccggcggcgttgacggcggcgtgcacgtc
accgacgtcaccaacgcatcccgcaccctgttcatggacctcgagaccctgcagtgggac
caggaaatcctggacatcttcggcgtaccggcctccatgatgcccgccatcaagtcctcc
tccgaggtctacggccatgtccacacgtcacagctgctccgggaaacgcctgttgccggc
atcctcggtgaccagcaggcggcaaccttcggccaggccgcgttccagcccggcgaagcc
aaaaacacctacggaaccggctgtttcctgatcttcaacaccggcgaggaaatcgttcac
tccaagaacggactcctcaccaccctcggatacaagctgggcgacgccaagccgcactac
gcccttgaaggctccatcgccgtcaccgggtccctgatccagtggctccgcgacaacctc
ggcatgatcagctcggcccctgaggtggaggaactggccgcgggtgttaaggacaacggt
ggcgtctacatcgtccccgccttctcaggcctgttcgccccctactggcgggcagacgca
cgcggtgccatcgtgggcctcacgcgtttcgccaacaagggccacatcgcccgcgcggca
ctggaagctaccgccttccagacccgcgaggtactcgacgccgtcaacgcagactcgggt
gttccgctcaccgagctgaaggtcgacggcggcatggtcgccaacgaggcactcatgcag
ttccaggcagacatcctgggcgtacctgtagtccgcccgaaggttgtggaaaccacggcc
ctcggtgcagcctatgcagccggcctggccgtgggattctggaaagacctgggcgagctc
agcgccaactggaacgaggacaagcgctgggagccccagctcccggcagaggagcaggag
cgtcagcttcgactctggaagaaggccgtgacaaagtccatggactgggtcgacgaagac
gtgaagtag

DBGET integrated database retrieval system