KEGG   Arthrobacter sp. Rue61a: ARUE_c24170Help
Entry
ARUE_c24170       CDS       T02215                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase Gmk
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00230  Purine metabolism
arr01100  Metabolic pathways
Module
arr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ARUE_c24170 (gmk)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ARUE_c24170 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 TOBE_2 TOBE
Motif
Other DBs
NCBI-ProteinID: AFR29318
UniProt: J7LS61
Position
complement(2670611..2671183)
Genome map
AA seq 190 aa AA seqDB search
MSKKPGLTVLAGPTAVGKGTVSTYIRDNYPEVWLSVSATTRAARPGEKDGVHYFFKSAEE
FDSLVAEGELLEWAVVHGQNRYGTLRSTVDAAIADGKSVLLEIDLQGARQVKAAVPDANF
VFLAPPSWDEMVRRLVGRGTETPEEQQRRLETAKLELAAEPEFDHTVINDDVRRAADELV
SLMGLTPHQR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagaaacccggactgactgtccttgcaggccccactgccgttggcaagggaacc
gtatccacctacatcagggacaactatccggaggtttggctctcagtctcggcaaccacc
cgggccgcgcgtccgggcgaaaaggatggcgttcactacttcttcaagtccgcggaggag
ttcgactccctggtagctgagggtgaacttctggagtgggccgtggtgcacggccagaac
cgctatggaacgcttcgcagcacggtggacgcggccatcgccgacggcaagtcagtgctg
ctggagatcgacctccagggcgcacgacaagtcaaggctgccgtcccggacgcgaatttc
gtgttcctggcaccgcccagctgggacgaaatggtccgccgcttggtgggccgcggtact
gaaactcccgaggaacagcagcgcaggctggaaaccgctaaactggaacttgctgctgaa
ccggagtttgaccacaccgtcatcaatgacgacgttcgccgggcagcggacgagcttgtt
tcactcatggggcttaccccgcaccagcgctaa

DBGET integrated database retrieval system