KEGG   Arthrobacter sp. Rue61a: ARUE_c25330Help
Entry
ARUE_c25330       CDS       T02215                                 

Gene name
mutM1
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:arr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    ARUE_c25330 (mutM1)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     ARUE_c25330 (mutM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     ARUE_c25330 (mutM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2798565..2799446
Genome map
AA seq 293 aa AA seqDB search
MTMPELPEVHGLCMYLDTQLHGAVLTEVRINSFSALKTADPPYTALEGRTILGAKRIGKF
VCIDADGLFFVFHLAKAGWVRYTEHPSSAGLRMGKSNISARLLLHRPADDAHIGVDLTEA
GTKKSLAIYVVKDPQDVPGIATLGPEPLSPDFDLDALAGILGSSSQQIKGLLRSQSVIAG
IGNAYSDEILHAARISPFATAKSLDQATVARLYAAMQEVLVGAVNAAAGKPSSELKDTKR
SNFRVHARTGQPCPVCGDTVREVSFADTSLQYCPTCQTNGKILADRRTSRFLK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgaccatgccggaactccccgaagtgcacggcctgtgcatgtacttggacacccaactc
cacggagctgtgctgaccgaggtccgaatcaactccttctctgcactcaagacggcggat
cccccctacacagcccttgaaggccggaccattcttggtgccaagcgcatcggaaaattc
gtgtgcatcgacgctgacggcctgttcttcgtgttccatctggccaaggccgggtgggtc
aggtataccgaacacccgtcctcagccggtttgcgcatgggcaagagcaacatctcagca
cggctcctgctccaccggcctgccgacgacgcccatatcggcgtggatctgacggaagcg
ggaaccaagaaaagcctcgccatctacgtagtgaaggatcctcaggacgttccgggaata
gccacgctgggaccggagcccctcagccccgattttgacctggacgcgctggcaggaatc
ctcggatcgagctcacagcagatcaagggcctgctgcgcagccagagcgtgatcgctggc
atcggcaacgcttacagcgacgagattctccacgccgccaggatttccccctttgccacc
gccaagtctttggaccaggcgacggtggccaggctatatgcggccatgcaggaggttctg
gtgggtgccgtcaacgcggcagccggcaagccgtccagcgagcttaaggacaccaagcgc
agcaatttccgggtgcatgccaggaccggccagccttgtccggtgtgtggagataccgtc
cgtgaggtgtcctttgcggacacctcacttcagtattgccctacatgccagaccaacggg
aagatcctcgccgaccgaagaacctcaaggttcctgaagtag

DBGET integrated database retrieval system