KEGG   Arthrobacter sp. Rue61a: ARUE_c26240Help
Entry
ARUE_c26240       CDS       T02215                                 

Gene name
mutM2
Definition
formamidopyrimidine-DNA glycosylase MutM (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:arr03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2892181..2893143)
Genome map
AA seq 320 aa AA seqDB search
MPELPEVEVVRRGLARWVRGRTITGVDVLDPRSIRRHALGTEDFIGNLEHATVLDVVRRG
KFLWMPLAMSGVSDTEPADELPKVALMAHLGMSGQLLMQDPVVPDEKHLKVRISLSPADG
MPEQLRFVDQRIFGGLFVTALVPTVDGGPGGLGETPLPEIAEEASHIARDPLDPYFSFDA
FYRKVKGRKTGLKRALLDQGVISGIGNIYADEALWRARLHYARATDKLRRADAERLVEAV
KDVMNAALAAGGTSFDSLYVNVNGDSGYFARSLNAYGRAGELCGRCEAIGLHSVMKREQF
MNRSSYTCPVCQPRPRNGRW
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaacttcctgaagtagaggttgtccgccgcggcttggcccggtgggttcgtggc
cgtaccatcaccggtgttgatgtccttgatccgcgctccatccgacgccatgccctcgga
acagaagactttatcgggaatcttgagcacgcaaccgtgctggacgtcgtccgtcgaggc
aagttcctctggatgcccctcgccatgtccggcgtatccgacaccgaacccgcggacgag
ctccccaaggtggcgctgatggcgcatctgggaatgagcgggcagctgctgatgcaggac
cccgtggtgccggatgagaagcacctgaaggtcagaatcagcctcagcccggcggacggg
atgcctgagcagctgcggttcgtggaccagaggatttttggtggcctgttcgtgactgct
ttggtgccaactgtcgacggcggccctggcggcctgggcgaaacgcccctgccggagatc
gccgaggaagcatcgcacattgcccgggatccgcttgacccttacttctcgtttgacgcg
ttctaccggaaggtcaagggccgcaagaccggcctgaagcgcgctcttctggaccaaggg
gtcatttccggcatcggcaacatctatgcggatgaagccttgtggcgtgcccgtctccac
tatgccagggccacagacaaacttcgccgggcggatgccgagcgcctggttgaggctgtg
aaagacgtcatgaacgccgcccttgccgcaggggggacgagttttgactccctctatgtg
aatgtcaatggcgattccgggtacttcgccaggtcgctcaatgcctacggacgtgccggt
gaactgtgtggccgttgcgaggcaatcggattgcacagcgtcatgaagcgggaacagttt
atgaaccgttcttcctatacctgcccggtgtgccagccgcggccgcggaatggacgttgg
tag

DBGET integrated database retrieval system