KEGG   Arthrobacter sp. Rue61a: ARUE_c26950Help
Entry
ARUE_c26950       CDS       T02215                                 

Definition
biotin/lipoyl attachment domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:arr01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:arr00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:arr00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:arr00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2970260..2970589
Genome map
AA seq 109 aa AA seqDB search
MAEISFPLPDLGEGLIEATVLDWLVEPGQQVERNQAIVELETTKSALELPSPQAGKVVRI
HGAPGDTINVGEPLIVFEVPDDTAGIVGTVPKDEAPKRRVRLSAVLDED
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaatttccttcccgctccccgacctcggtgagggcctcattgaggcaaccgtg
ctggactggctcgtggagcccggtcagcaggtggaacgcaaccaagcgatcgtggagctg
gagaccactaagtcggccctcgaattgcccagcccgcaggcgggtaaagtggtgcgtatt
cacggtgcgcccggtgacacaatcaacgttggcgagccgctgatcgtgttcgaggtcccg
gatgacaccgccgggatcgtgggcactgttccgaaggacgaagcacccaagcgccgggtc
cgcctgagcgccgtactcgatgaggactga

DBGET integrated database retrieval system