KEGG   Arthrobacter sp. Rue61a: ARUE_c27670Help
Entry
ARUE_c27670       CDS       T02215                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00260  Glycine, serine and threonine metabolism
arr00750  Vitamin B6 metabolism
arr01100  Metabolic pathways
arr01110  Biosynthesis of secondary metabolites
arr01120  Microbial metabolism in diverse environments
arr01230  Biosynthesis of amino acids
Module
arr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARUE_c27670 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ARUE_c27670 (thrC)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ARUE_c27670 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AFR29656
UniProt: J7LXJ6
Position
complement(3043118..3044176)
Genome map
AA seq 352 aa AA seqDB search
MPVTEATKVITLGEGGTPLVHAQKLSELTGSEVYLKVEGMNPTGSFKDRGMTMAMTAAVE
AGAKAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQAIAHGATLLQVDGNF
DNCLDIARKLGEAYPVFLVNSVNPARIQGQKTGAFEVVDTLGDAPDIHVLPVGNAGNISA
YWKGYKEYSAPFETTNGTLPAVSTKTPVMWGFQAAGAAPFVAGHPITEPDTIATAIRIGN
PASWETAVAARDESGGLIEAVTDDEILAAHRWLSAKEGVFVEPGSAAGVAGLIKKHAAGE
VPSGKTIVITVTGHGLKDPQWALRTEDGSDVQPVKVPNDVVTVAAELGLEEN
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgtaacggaagccaccaaggtcatcaccctgggagagggcggcactccgctcgtc
cacgcgcagaagctttccgagctgaccggctcagaggtgtacctgaaggtcgaaggcatg
aaccccacgggttccttcaaggaccgcggcatgaccatggccatgacggctgccgttgaa
gccggtgcaaaggctgttgtttgcgcttccaccggcaacacctccgcctcggctgcggcc
tacgccactgcggcaggcctcaagtgcgctgtgcttgtacccgaaggcaagatctccatg
ggcaagctgagccaggccatcgcgcacggcgccacactgctccaggttgacggcaacttt
gataactgcctggacatcgcccggaagctcggcgaggcctacccggtgttcctggtgaac
tcggtcaacccggcccgtatccagggccagaagaccggtgccttcgaagtggtggacacc
ttgggcgatgcccctgacatccacgtactgcctgtaggcaacgccggcaacatcagtgct
tactggaagggctacaaggaatactccgcgcccttcgagaccactaatggaacacttcct
gctgtttccaccaagacgcccgtcatgtggggcttccaggccgccggtgccgcgccgttc
gttgcaggccaccccatcaccgagcccgacacgattgccaccgccatccgcatcggcaac
ccggcctcgtgggaaaccgcagttgcggcccgtgacgaatccggtggactgatcgaggct
gtcaccgatgacgagattctggctgctcaccgctggctttcggcaaaggaaggcgttttc
gttgaacccggctccgctgccggtgtcgcgggcttgatcaagaagcatgccgccggcgag
gttccgtcgggcaaaaccatcgtcatcacggttaccggacacggactcaaggacccgcag
tgggccctccgcaccgaagacggcagcgacgtgcagcccgtcaaggtgccgaacgacgtc
gtcactgttgccgcagaactgggactggaagaaaactaa

DBGET integrated database retrieval system