KEGG   Arthrobacter sp. Rue61a: ARUE_c28990Help
Entry
ARUE_c28990       CDS       T02215                                 

Gene name
nagZ
Definition
beta-hexosaminidase NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c28990 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    ARUE_c28990 (nagZ)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ARUE_c28990 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3205607..3206893)
Genome map
AA seq 428 aa AA seqDB search
MRKFPSIASLSVSIATAGVLLVTASGCSSGPSNSGQASAEGTPSVSPSSPTATPAPTSPP
ATTTPSAVPSPPPSAAPAPAPSTPSPAEQQLAALSLEQRVGQLFMVAAKASGAEPGTMEA
LTKYHAGNVYLSGRSKAGTAPTTAVVSSLTGTVSAATTGGVPLFVATDQEGGYVQVLSGP
GFSTIPTAVLQASSGAAKLRTDAATWGKELRSVGVNVNLAPVLDTVTSPEFSPSNAPIGH
FQREYGYDPASVSLLGNAFADGMKDAGVAPVVKHFPGLGRVVPNTDVSSDVRDTATTRND
PALEPFHAAIKSGTQWVMVSNAYYDKIDAANIAPFSPTVMETMLRADAGFTGIVLSDDLC
SAAQLEAWSDAERALNFFGAGGTMLVCADPTSIPAMHRAVAQKATSDPAFRAKVDAAALT
VLRVKAAH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagttcccgtccattgcttctttgagtgtcagcattgccaccgccggagtactt
ctggtgacggcctcgggatgttccagtggcccatccaactccggccaggcctcggcggag
gggacgccttctgtatctccttcttcgccgacagccacgccggcacctacatccccgccg
gcgacaaccacgccgtctgccgttccttccccgcctccttccgccgcaccggccccggcg
ccgagcacaccgtcacctgcggagcagcaactcgcagcgctcagccttgagcagcgggta
ggacaactgtttatggtggcggccaaggccagcggcgcggaaccgggcaccatggaagca
ctgacgaagtatcacgccggcaacgtttacctcagcggacgcagcaaggctggaactgcc
ccgactacagctgtcgtgtcgtcgttgaccggtacggtctcggctgccacaacaggtggg
gtacccctatttgtggcgacggaccaagaaggaggatacgtgcaggttctgtccggtccc
gggttctccactattccgaccgcagtgctccaggcgtcctccggggcggccaagctccgc
acggatgctgcaacgtgggggaaggaacttcgtagcgtaggcgtcaatgtgaacctcgcg
ccggtccttgatacagtgaccagcccggagttttccccgtcaaatgcccccatcggccat
tttcagcgggagtacggctatgaccctgccagcgtctcgctcctgggcaacgcctttgcc
gatggcatgaaggacgcgggcgtcgctcccgtggtcaaacacttcccgggccttggccgg
gtggttcccaacaccgatgtcagcagcgatgtccgtgacacggccaccacccggaacgat
cctgcgctggagccgttccacgcggccatcaaatcaggcacccaatgggtcatggtgtcc
aatgcttactacgataagattgacgccgccaacatcgcaccgttctcgcccaccgtgatg
gaaaccatgctccgtgctgacgccggcttcacggggatcgttctttcagacgatctctgc
agtgccgcgcagctggaagcatggtccgatgccgagcgcgccctgaacttcttcggtgca
ggcggaaccatgctggtgtgcgccgatcccacgagcattccggccatgcaccgggcggtg
gcgcagaaggctacgtcagatcctgctttccgggccaaggtggatgctgcagcgttgaca
gtgctgcgggtcaaagccgctcactaa

DBGET integrated database retrieval system