KEGG   Arthrobacter sp. Rue61a: ARUE_c29020Help
Entry
ARUE_c29020       CDS       T02215                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase HemB (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARUE_c29020 (hemB)
Enzymes [BR:arr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ARUE_c29020 (hemB)
Exosome [BR:arr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARUE_c29020 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3209447..3210379)
Genome map
AA seq 310 aa AA seqDB search
MRRLTAENRLAPADLILPAFIREGLTEPSPISSMPGVVQHTTESLKRAAAEAVELGVGGI
MLFGVPAVRDAQGTASLDPDGVLNKAIRDVKAEVGDDLVIMGDVCLDEFTDHGHCGVLDS
EGYVDNDATLEIYGRMAVAQADAGAHVLGPSGMMDGQIAVIRQALEESGHKNTAVLAYAA
KYASAFYGPFREAVDSQLKGDRRTYQMDAANRREAILEVELDLEEGADMVMVKPAMSYLD
ILADVAAMSPVPVSAYQISGEYAMIEAAAANGWIDRRGAITESVLGIKRAGADTVLTYWA
SKLAGWLKES
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggctcaccgccgaaaaccgcctggcgcccgcggacctgatcctcccggcgttc
ataagggagggcctcacagagcccagccccatcagctccatgccgggagtggtccagcac
accaccgagtccctgaaacgggcggccgcagaagccgtggagttgggcgtgggcggcatc
atgctgttcggtgtgcccgccgtgcgcgacgcgcaaggcaccgcttcattggacccggat
ggcgtcctgaacaaggccatccgcgacgtcaaagccgaggtcggcgatgacctggtgatt
atgggcgacgtttgcctcgatgagttcacggaccacggccattgcggcgtcctcgattcc
gaaggctacgtagacaacgacgccacgctggagatctacggccggatggctgttgcccaa
gcggacgccggagctcacgtgctggggccctcgggaatgatggacggacagatcgcagtc
atccgtcaagcgctggaggagtccgggcacaagaacacagcagttcttgcctatgcagcc
aagtacgcgtcagcattctatggcccgttccgtgaggccgtggattcccagctcaagggt
gatcgccggacttaccagatggacgcggcaaaccgtcgggaagccatcctggaagttgaa
ctggacctcgaagaaggcgctgacatggtcatggtcaagcctgccatgagctacttggac
atcctggccgacgtcgcagccatgagcccggtgccggtgtcggcctaccaaatctcgggc
gagtacgccatgatcgaagcggccgccgccaatggctggatcgacaggcggggtgccatc
accgaatccgtcctcggcatcaagcgtgccggagcggacaccgtcctgacctactgggcc
tccaaactcgcaggctggctgaaggagtcctaa

DBGET integrated database retrieval system