KEGG   Arthrobacter sp. Rue61a: ARUE_c29030Help
Entry
ARUE_c29030       CDS       T02215                                 

Gene name
hemD2
Definition
uroporphyrinogen III synthase HemD (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:arr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3210424..3211179)
Genome map
AA seq 251 aa AA seqDB search
MLPLIDFERAGDQAPLDSALDRLVAGNFDWLVISSITTVRVLLDKAAQRGVDLADLVPSG
TKVATIGPSSRQVLESVGLTVALSPTDVQSAEGLLAVWESSGGRVFLPQADIASPGLREG
LTARGADVTSVVAYNTVDYPARPELRLTAELPSGVVVSRGDMPPTLSPDEARTAMDVGSL
DAVVAASPSAARRIAHIFPALGTCRFIAIGRPTAAEASRIGLTVAATAKEPTPDGIVAAL
ESVFANEGNPQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgttgccgctcattgatttcgagagggccggagaccaggctccccttgattcagccttg
gaccgtttggtggctggcaatttcgattggctggtgatcagcagcatcaccactgtccgg
gttctcctggacaaagctgcgcagcgcggcgtcgaccttgcggacctcgtgccatcggga
acaaaggtggccaccattggaccctcgtcccggcaggtccttgaatccgttggtctcacc
gttgctttgtcgcctaccgatgtccaatcggccgaaggtctgcttgctgtgtgggagtca
tccggtggacgggttttcctgccacaagcagatatcgcgtcgcccggcctgcgggaaggc
ttgaccgccagaggcgcggacgtgacctccgttgtcgcctacaacacagtcgattaccca
gcccgtccggaactccgcctaacagcggagcttccgtccggcgtcgtagtttcccggggc
gacatgccgccgactctcagcccggacgaggcacggaccgcaatggacgtcgggagcctg
gacgccgtggtggctgcttcacccagcgctgcgcgtcgcatcgcccacatatttcctgct
ttgggcacctgccgcttcatcgccatcgggcgtccgacggcggcagaggcctcccggatc
ggcctcaccgtggcagccaccgccaaagaaccaaccccggacggcatcgtggccgccttg
gaatctgttttcgccaacgaagggaacccgcaatga

DBGET integrated database retrieval system