KEGG   Arthrobacter sp. Rue61a: ARUE_c29420Help
Entry
ARUE_c29420       CDS       T02215                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase DapE
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00300  Lysine biosynthesis
arr01100  Metabolic pathways
arr01120  Microbial metabolism in diverse environments
arr01230  Biosynthesis of amino acids
Module
arr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ARUE_c29420 (dapE)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ARUE_c29420 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: AFR29828
UniProt: J7LTM5
Position
complement(3247493..3248617)
Genome map
AA seq 374 aa AA seqDB search
MTLNPAPALLDLRQDVAVLTAALIDFNSVSGNETELADAVESALRAIPAYTVTRDGDAII
ARTELGRSERVILAGHLDTVPLPTVEGSLGTVPATWESGVPGEGILYGRGTTDMKGGVAV
QLALAATLFDDGRQPDKDVTFVFYDHEEVEAVKSGLGRLVRNHGDLLQGDFAILLEPTHG
TVEGGCNGTSRFEATTIGETAHSARAWMGVNAIHAAAPILARLADYEPQTINVDGLDYRE
SLNAVKINGGTAGNVIPDRCVVEINYRFAPDKTPDQAEAHVRDLLEGFDVVRTDAAAGAR
PGLNHPAAASFVAAVGAEPKPKYGWTDVARFSELGIPAVNFGPGDPLLAHKDNEHVDAEA
IRECLRALRTWLTP
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgaaccctgctcccgccctccttgacctgcgccaggacgttgccgtgctgaca
gccgcgctcattgacttcaacagcgtgtccggcaacgagaccgaactcgccgacgccgtc
gagtccgcccttcgtgccatcccggcctataccgtgacccgtgacggcgacgccatcatt
gcgcgcaccgaacttggccgttccgagcgcgtcatcctggccggacatctggacaccgtg
ccccttcccaccgtggagggctcactgggcaccgttccggccacgtgggagtccggggtt
cccggtgaaggcatcctgtacgggcgcgggaccacagacatgaagggtggcgtggcggtg
cagctcgccctcgcggcaacactgttcgacgacgggcggcagccggataaggacgtcacc
ttcgtcttctacgaccatgaggaagtggaagcggtcaagagcggcctcggaaggttggtc
cgcaaccacggtgacctgttgcagggcgacttcgcgatcctgctggagccaacccacggc
acggtggaaggcggctgcaacggcaccagccgcttcgaagccacaaccatcggcgaaaca
gcccactctgcacgcgcatggatgggcgtcaacgcgatccacgccgcagcccccatcctg
gcgcggctcgccgactacgaaccgcagaccatcaacgtggacggcctcgattaccgtgag
agcctcaacgcggtgaagatcaacggcggaactgccggcaacgtgatcccggaccgctgc
gtggtggaaatcaactaccgtttcgctccggacaaaacaccggaccaggccgaggcccac
gtccgggacctcttggaaggattcgacgtcgtccgtacggacgccgctgccggcgcgcgt
cccggactcaaccacccggccgcagcctccttcgttgccgcagtcggtgccgagcccaag
cccaaatacggatggaccgacgtcgcgcgtttcagtgagctgggcatcccggcagtgaac
ttcggacccggcgatccgctgctggctcacaaggacaacgagcacgtggacgccgaagcc
atccgtgagtgcctccgtgcactgaggacctggctgacaccgtag

DBGET integrated database retrieval system