KEGG   Arthrobacter sp. Rue61a: ARUE_c29750Help
Entry
ARUE_c29750       CDS       T02215                                 

Gene name
gLB
Definition
beta-galactosidase GLB (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARUE_c29750 (gLB)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ARUE_c29750 (gLB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3281079..3282875)
Genome map
AA seq 598 aa AA seqDB search
MNNALLSYHDAVLYRSGEPYRILAGAIHYFRVHPDLWQDRLRRLKAMGANTVDTYVAWNF
HQPKRDEAPDFSGWQDLGRFMDLAAEEGLDVIVRPGPYICAEWDNGGFPSWLTGIPGIGL
RCMDPVFTAAIEEWFDHLLPIVASRQTSAGGPVVAVQIENEYGSYGDDHEYIRWNRRALE
ERGITELLFTADGGTDYFLDGGAVEGTWATATLGSRGDEAVATWQRRRPGEPFFNVEFWG
GWFDHWGEHHHGRDAEDAALEARKMLDLGGSLCAYMAHGGTNFGLRSGSNHDGTMLQPTV
TSYDSDAPIAENGALTPKFHAFRKEFYRAQGVDDLPELPADLLADAPVLPAQSLPLSPGP
ELLELVRDAGKPVSSVKPLSFEQLGLDGGMVLYSSEAILPGRPDAPTESRLKITGLNDRA
YVWVDGTFAGVLDDVNGSEGLPVTGTGIAAKLEILVENLGRINYGPLTGHGKGILGGVLV
NQRYTFHWTQTPVDLAEWGPEDLEGLAGSDFEVGEPADTFIALPDSGKGFVWLNGFLLGR
YWEKGPQVTLYAPAPLLKAGRNSIKVLELGKPGTVVELREAPDLGPEEAGPIKAAELP
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacgccctgctgagctaccacgacgccgtcctttaccgttcgggtgaaccgtat
cgcatcctcgccggagccatccactacttccgtgtgcacccggacctgtggcaggaccgg
ctgcgtcggctcaaggcgatgggcgccaacacggtggacacgtacgttgcttggaacttc
caccagcctaagcgcgacgaagctccggacttcagcggctggcaggacttgggccggttc
atggacctcgcagccgaggaagggctggacgtcatcgtccgccccgggccctacatttgt
gccgagtgggacaacggcggcttcccctcatggctgacaggcattcccggcatcggcctt
cggtgcatggacccggtgttcaccgctgccatcgaggagtggttcgatcacttgcttccc
atcgtcgcctcacggcagacctccgcgggtggtccggtggtggcggtacaaatcgagaac
gaatacggcagctacggcgacgaccacgagtacattcgctggaaccggcgcgcgctggag
gagcgcggtatcactgaactccttttcacagcagacggcggcacggactacttcctcgac
ggcggcgcggtggaaggcacatgggcgacagcgacgttgggaagccgcggcgacgaagcg
gtagctacgtggcagcgacgccggcccggcgagccgttcttcaacgttgagttttggggt
ggctggttcgaccactggggcgaacaccatcacgggcgggatgccgaagacgccgcattg
gaagcacgcaagatgctggatctgggcggttcactctgtgcctacatggcccacggcgga
accaactttggcctccgctccggcagtaaccacgatggcaccatgcttcagcccacggtc
accagctatgactctgatgcgcccatcgctgagaacggcgccctgactcccaagtttcat
gccttccgtaaggagttctaccgggcacagggcgttgacgacctgcccgaacttccagct
gacttgctggcagacgcgccggtactcccggcgcagtccctgccgttgagccccggaccg
gagctgctggagctcgtccgagacgccggcaagccggtcagcagcgtcaaaccgctcagt
ttcgaacaactgggactcgacggcggcatggtcctctactcctccgaagccatactgccg
ggccgtcccgatgcccccacagagagccggttgaagatcaccggcctcaatgaccgtgcc
tacgtttgggtggacggcacctttgccggtgtcctggacgacgtcaacggctctgaagga
ctgcctgtcacgggcaccggcatcgctgccaagctcgaaatcctcgtggaaaacctcggc
cgcatcaattacggcccgctgaccggtcacggcaagggaatcctgggcggcgtcctcgtc
aatcagcgctacaccttccactggacgcagacacctgttgacctcgcagagtggggtccg
gaagacctggagggactggctggaagtgactttgaggtgggggaaccagccgacaccttc
attgccttgcccgattccgggaagggcttcgtttggctgaacggcttccttttgggcagg
tactgggagaagggcccgcaggttaccctctacgcacccgctccgttgctcaaagccggc
cgcaacagcatcaaggtgctggaactcgggaagccggggaccgtcgtcgaacttcgcgag
gcgcctgacctaggtcccgaagaagcgggtccgatcaaggcggccgaacttccgtaa

DBGET integrated database retrieval system