KEGG   Arthrobacter sp. Rue61a: ARUE_c30050Help
Entry
ARUE_c30050       CDS       T02215                                 

Gene name
yngB
Definition
UTP--glucose-1-phosphate uridylyltransferase YngB (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARUE_c30050 (yngB)
   00052 Galactose metabolism
    ARUE_c30050 (yngB)
   00500 Starch and sucrose metabolism
    ARUE_c30050 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c30050 (yngB)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ARUE_c30050 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3304877..3305782)
Genome map
AA seq 301 aa AA seqDB search
MTLENNAVRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVKVGLHDVLMI
TGRSKRALEDHFDRVPALEATLAEKGDTAKLEAIQSATNLGDIHYVRQGDPNGLGHAVLR
AKQHVGYEPFAVLLGDDLIDAREDLLSEMIAVQQKTGGSVVALIEVEPSKISAYGCADVE
DNGEDGYVRIKQLVEKPSPEEAPSNLAVIGRYVLHPAVFEVLEKTAPGRGGEIQLTDALE
VLAAGEGEGYGVYGVVFRGRRYDTGDKLSYLKACIELACEREDLGPELREWLPNFTAALP
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgactctagaaaacaacgctgtccgtaaggccgtcattcccgcagcgggccttggcacc
cggttccttcccgccacgaaggcgatgccgaaggaaatgctgcccgtagtggacaagcct
gccatccagtatgtcgtcgaagaagcggtcaaggtaggcctgcatgacgtcctgatgatc
acaggacgcagcaagcgagcactggaagaccactttgaccgtgtcccggctcttgaggcc
accttggcggaaaagggcgataccgccaagcttgaagccattcagtccgccaccaacctc
ggtgacattcactacgtccggcaaggcgacccgaatggtcttggccacgctgtccttcgt
gcgaagcagcacgtaggttacgagccctttgccgtcctgcttggcgatgacctgatcgac
gcccgcgaagacctgctgagcgaaatgatcgccgttcaacagaagaccggcggttccgtg
gttgccctcatcgaggtggagccctccaagatcagcgcttatggttgcgccgatgttgag
gacaacggcgaggacggctacgtccgcatcaagcagctcgttgagaagccttcccccgaa
gaagcaccgtcaaaccttgccgtgatcggacgctacgtcctgcacccggccgtgttcgaa
gtcttggagaagaccgcccccggtcgcggtggagagatccagctgacagacgcccttgag
gtgcttgccgccggggaaggcgaaggctatggcgtctacggcgttgtcttccgcggccgc
cgctacgacaccggtgacaagctcagctacctcaaggcctgcatcgagcttgcctgcgaa
cgtgaagacctcggtcctgaacttcgtgagtggctgcccaacttcaccgccgcacttccc
aaataa

DBGET integrated database retrieval system