KEGG   Arthrobacter sp. Rue61a: ARUE_c30050Help
Entry
ARUE_c30050       CDS       T02215                                 

Gene name
yngB
Definition
(GenBank) putative UTP--glucose-1-phosphate uridylyltransferase YngB
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
arr00040  Pentose and glucuronate interconversions
arr00052  Galactose metabolism
arr00500  Starch and sucrose metabolism
arr00520  Amino sugar and nucleotide sugar metabolism
arr01100  Metabolic pathways
arr01130  Biosynthesis of antibiotics
Module
arr_M00362  Nucleotide sugar biosynthesis, prokaryotes
arr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARUE_c30050 (yngB)
   00052 Galactose metabolism
    ARUE_c30050 (yngB)
   00500 Starch and sucrose metabolism
    ARUE_c30050 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    ARUE_c30050 (yngB)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ARUE_c30050 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFR29890
UniProt: J7LR18
Position
complement(3304877..3305782)
Genome map
AA seq 301 aa AA seqDB search
MTLENNAVRKAVIPAAGLGTRFLPATKAMPKEMLPVVDKPAIQYVVEEAVKVGLHDVLMI
TGRSKRALEDHFDRVPALEATLAEKGDTAKLEAIQSATNLGDIHYVRQGDPNGLGHAVLR
AKQHVGYEPFAVLLGDDLIDAREDLLSEMIAVQQKTGGSVVALIEVEPSKISAYGCADVE
DNGEDGYVRIKQLVEKPSPEEAPSNLAVIGRYVLHPAVFEVLEKTAPGRGGEIQLTDALE
VLAAGEGEGYGVYGVVFRGRRYDTGDKLSYLKACIELACEREDLGPELREWLPNFTAALP
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtgactctagaaaacaacgctgtccgtaaggccgtcattcccgcagcgggccttggcacc
cggttccttcccgccacgaaggcgatgccgaaggaaatgctgcccgtagtggacaagcct
gccatccagtatgtcgtcgaagaagcggtcaaggtaggcctgcatgacgtcctgatgatc
acaggacgcagcaagcgagcactggaagaccactttgaccgtgtcccggctcttgaggcc
accttggcggaaaagggcgataccgccaagcttgaagccattcagtccgccaccaacctc
ggtgacattcactacgtccggcaaggcgacccgaatggtcttggccacgctgtccttcgt
gcgaagcagcacgtaggttacgagccctttgccgtcctgcttggcgatgacctgatcgac
gcccgcgaagacctgctgagcgaaatgatcgccgttcaacagaagaccggcggttccgtg
gttgccctcatcgaggtggagccctccaagatcagcgcttatggttgcgccgatgttgag
gacaacggcgaggacggctacgtccgcatcaagcagctcgttgagaagccttcccccgaa
gaagcaccgtcaaaccttgccgtgatcggacgctacgtcctgcacccggccgtgttcgaa
gtcttggagaagaccgcccccggtcgcggtggagagatccagctgacagacgcccttgag
gtgcttgccgccggggaaggcgaaggctatggcgtctacggcgttgtcttccgcggccgc
cgctacgacaccggtgacaagctcagctacctcaaggcctgcatcgagcttgcctgcgaa
cgtgaagacctcggtcctgaacttcgtgagtggctgcccaacttcaccgccgcacttccc
aaataa

DBGET integrated database retrieval system