KEGG   Arthrobacter sp. Rue61a: ARUE_c31240Help
Entry
ARUE_c31240       CDS       T02215                                 

Gene name
pfp
Definition
(GenBank) pyrophosphate--fructose 6-phosphate 1-phosphotransferase Pfp
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c31240 (pfp)
   00030 Pentose phosphate pathway
    ARUE_c31240 (pfp)
   00051 Fructose and mannose metabolism
    ARUE_c31240 (pfp)
   00052 Galactose metabolism
    ARUE_c31240 (pfp)
  Energy metabolism
   00680 Methane metabolism
    ARUE_c31240 (pfp)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARUE_c31240 (pfp)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     ARUE_c31240 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3435122..3436147
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGSVLKGIAIHGQEFVGFRDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKAHMERLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKASIEQITEWVQEAHDRGRAPLVVVAEGFVPDHMESPHSERGLDTF
GRPRLGGIADQLAPEIEARTGIETRATILGHIQRGGVPTAYDRVLATRLGMAAIDSVVEG
RWGTMVALKGTDISHVGFEEALGKLKTVPQHRYDEASVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcattcttaccagcggtggcgactgccccggcctcaacgcagtgatccgg
ggatcagtcctcaagggtattgccatccacggccaggagtttgtgggcttccgcgacggc
tggcgtggtgtggttgaaggtgatgtcatcgacatcccccgcaccatggtccgcggtatt
gccaagcagggtggcaccattctgggcacctcccgcaccaaccccttcgaaaacggcggt
ggcccggacgtcatcaaggcgcacatggaacgcctgggcattgacgccatcattgcaatt
ggaggcgagggaacgctggcagcagccaagcgcctcaccgacgcgggcctgaagattgtt
ggtgtccccaagaccgtggacaacgacctcgacgccaccgactacaccttcggtttcgat
accgccgtgcagatcgcaactgaggccatcgaccggctccgcaccaccggcgaatcccat
caccgctgcatgatcgccgaagtcatgggccgccacgtcggctggatcgccttgcacgcc
ggcatggcagcgggcgcccacgccatcctcatcccggaacagaaggcaagcatcgagcag
atcaccgaatgggtccaggaagcccacgaccgtggccgtgcgccgcttgtggtggttgct
gaaggctttgttccggaccacatggagtccccgcactccgagcgcggcctggataccttc
ggccgtccccgccttggcggcatcgccgatcagctggcacccgagattgaggcgcgcacg
ggcatcgaaacacgggccacgatcctcggccatatccaacgtggtggcgtccccaccgcc
tacgatcgcgttttggcgacgcgcctgggcatggctgccatcgattccgtagtggaaggc
cgctggggcaccatggtggcactgaagggtacggacatctcccacgtgggcttcgaggaa
gcgctcggcaagctcaagacagtgccgcaacaccgctacgacgaagcgtctgtgctcttc
ggctag

DBGET integrated database retrieval system