KEGG   Arthrobacter sp. Rue61a: ARUE_c31240Help
Entry
ARUE_c31240       CDS       T02215                                 

Gene name
pfp
Definition
pyrophosphate--fructose 6-phosphate 1-phosphotransferase Pfp (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARUE_c31240 (pfp)
   01230 Biosynthesis of amino acids
    ARUE_c31240 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARUE_c31240 (pfp)
   00030 Pentose phosphate pathway
    ARUE_c31240 (pfp)
   00051 Fructose and mannose metabolism
    ARUE_c31240 (pfp)
   00052 Galactose metabolism
    ARUE_c31240 (pfp)
  Energy metabolism
   00680 Methane metabolism
    ARUE_c31240 (pfp)
Enzymes [BR:arr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARUE_c31240 (pfp)
Protein phosphatases and associated proteins [BR:arr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARUE_c31240 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3435122..3436147
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGSVLKGIAIHGQEFVGFRDGWRGVVEGDVIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPDVIKAHMERLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKASIEQITEWVQEAHDRGRAPLVVVAEGFVPDHMESPHSERGLDTF
GRPRLGGIADQLAPEIEARTGIETRATILGHIQRGGVPTAYDRVLATRLGMAAIDSVVEG
RWGTMVALKGTDISHVGFEEALGKLKTVPQHRYDEASVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggcattcttaccagcggtggcgactgccccggcctcaacgcagtgatccgg
ggatcagtcctcaagggtattgccatccacggccaggagtttgtgggcttccgcgacggc
tggcgtggtgtggttgaaggtgatgtcatcgacatcccccgcaccatggtccgcggtatt
gccaagcagggtggcaccattctgggcacctcccgcaccaaccccttcgaaaacggcggt
ggcccggacgtcatcaaggcgcacatggaacgcctgggcattgacgccatcattgcaatt
ggaggcgagggaacgctggcagcagccaagcgcctcaccgacgcgggcctgaagattgtt
ggtgtccccaagaccgtggacaacgacctcgacgccaccgactacaccttcggtttcgat
accgccgtgcagatcgcaactgaggccatcgaccggctccgcaccaccggcgaatcccat
caccgctgcatgatcgccgaagtcatgggccgccacgtcggctggatcgccttgcacgcc
ggcatggcagcgggcgcccacgccatcctcatcccggaacagaaggcaagcatcgagcag
atcaccgaatgggtccaggaagcccacgaccgtggccgtgcgccgcttgtggtggttgct
gaaggctttgttccggaccacatggagtccccgcactccgagcgcggcctggataccttc
ggccgtccccgccttggcggcatcgccgatcagctggcacccgagattgaggcgcgcacg
ggcatcgaaacacgggccacgatcctcggccatatccaacgtggtggcgtccccaccgcc
tacgatcgcgttttggcgacgcgcctgggcatggctgccatcgattccgtagtggaaggc
cgctggggcaccatggtggcactgaagggtacggacatctcccacgtgggcttcgaggaa
gcgctcggcaagctcaagacagtgccgcaacaccgctacgacgaagcgtctgtgctcttc
ggctag

DBGET integrated database retrieval system