KEGG   Arthrobacter sp. Rue61a: ARUE_c32270Help
Entry
ARUE_c32270       CDS       T02215                                 

Gene name
glsA2
Definition
glutaminase GlsA (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARUE_c32270 (glsA2)
   00330 Arginine and proline metabolism
    ARUE_c32270 (glsA2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ARUE_c32270 (glsA2)
Enzymes [BR:arr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     ARUE_c32270 (glsA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3542082..3542999)
Genome map
AA seq 305 aa AA seqDB search
MTVDIQNLLEDIVGAVQPHIGQGSVANYIPQLGAVDAHQFGISVVTRDGDVFSAGDAHVE
FSIQSISKVFALALVLASDGDRIWKRVFREPSGNPFNSLVQLESEEGIPRNPFINAGAIV
VTDRLLSLTGNAAHAVRDLMRQETGNAGVDTDHHVAGSELANGHRNASLAHFLASCGNLE
NPVDDVLDSYAKQCALAMTCEDLALATRFLASNGLGGDGTLLLSPAQTKRINAVMLTCGT
YDAAGEFAYRVGLPGKSGVGGGIVAVVPNKCAISVWSPGLGRSGNSVAGVAALDEFTTRT
GWSVF
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtggacattcagaacctacttgaggacattgtcggagcagttcaaccccacatc
ggccaaggatccgtggctaattacattccccagctcggggcggtggacgctcaccagttc
gggatctcggtagtcacccgggatggcgacgtgttttcggccggggacgcccacgtggag
ttctccatccaaagcatctccaaggtcttcgccctcgccttggtgctggcttccgatggc
gaccgcatctggaagcgggtgttccgcgaaccctcgggtaatccgttcaattccttggtc
cagttggagagcgaggaaggcataccccgcaacccgttcatcaacgccggggcgatcgtg
gtgacggaccggctccttagcctgacaggcaacgccgcccatgccgtgcgtgacttgatg
cgccaagagacaggcaacgcaggcgttgacactgatcaccacgttgccggctcggagctg
gccaacggtcaccgcaatgcctcgctggcgcatttcctggcaagttgcggcaacctggaa
aatccggtggacgacgttctggactcctacgcaaagcagtgcgccctggccatgacctgt
gaagacctggcgctcgcaacccggttcctggcctccaacggtttggggggagacggaacc
ctgttgctgtcaccggcgcagaccaagcggatcaacgccgtgatgctcacctgcggaacg
tacgatgccgcgggagaattcgcgtatcgcgtgggccttccgggcaagagtggcgtgggc
ggggggatcgtggccgtggttcccaacaagtgcgccatcagcgtgtggagccctggcctg
ggaaggtccgggaattccgtggcaggcgtggccgcgctggacgaattcactacgcgtact
ggctggtcggtcttttag

DBGET integrated database retrieval system