KEGG   Arthrobacter sp. Rue61a: ARUE_c34460Help
Entry
ARUE_c34460       CDS       T02215                                 

Gene name
bgaB2
Definition
beta-galactosidase 1 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
arr  Arthrobacter sp. Rue61a
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:arr00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3788802..3790892
Genome map
AA seq 696 aa AA seqDB search
MTGTLHSYLQYHQYQHGQPDEGVPLTSPEIPRSPSVWNSIHGLAYGGDYNPEQWPEDIRL
EDIELMKEAGVNFLSVGIFSWGLLEPTEGNYDFGWLDDVMDNLHGAGIKVALATATASPP
AWLARKYPEILPVTAEGIRLERGSRRHYTPSSSVYRRYATAMTRVIAERYKNHPALALWH
VDNELGCHVGEFHGEEDAAAFRAWLERRYGSIEALNEAWGTAFWSQHYASFDEIIPPGAA
PTTLNPGQQLDFARFNSWAFIDYYRELLAVIREVTPGIPATTNFMVSSATKALDYFDWSK
DMDVVANDHYLVAADPEREIELAFSADLTRGVAGGEPWILMEHSTSAVNWQPHNQPKMPG
EMLRNSLTHVARGADAVMFFQWRQSKAGSEKFHSAMVPHGGRDTQVWRNVVDLGDALSKL
ETVKGSRVESRVAIVFDYEAWWASELDSHPNNSLKYLDTMRAFHRSLYKRGITADFVHPS
SDLSGYDLILVCTLYSVTDAAAASIAAAAEGGATVLISYFSGIVDERDHVRLGGYPGAFR
ELLGVRGEEFHPLLPGTSVTLSDGTVGSVWSEHVHAAEGTEILATFTDYPLGEVPALTRR
SVGTGSAWYLATLPDADGIDSLTARLVEEAGVRAVTEVSAGVELTRRRAADGRTFLFAIN
HSQEDVTVKADGGELLSGARFTGVVPAGAVAVIAED
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
ttgaccggtacgctgcactcataccttcagtaccaccagtaccagcacggccaacctgac
gaaggagtccccttgacctcccccgaaatcccacgcagtccatccgtctggaacagcatc
cacggcctcgcttacggcggtgactacaaccccgagcagtggccggaggacatccggctc
gaggacatcgagctcatgaaggaagccggagtcaacttcctgagcgtcggcatattctcc
tggggtctcctggagcccactgaagggaactacgatttcggctggttggacgatgtcatg
gacaacctccacggggccgggatcaaggttgcactggcgaccgccacagcctctccccct
gcctggctggcccgcaaataccccgagatccttcccgtcaccgcggaaggaatccggctg
gaacgtggctcgcgacgccactacacgccgtcgtcgtccgtgtaccgcaggtacgccacc
gccatgacgcgggtcatcgccgaacgctacaagaaccacccggccttggcactctggcac
gtggacaacgaacttggctgccacgttggcgagttccatggcgaggaagacgccgccgct
ttccgcgcttggctggaacgccgttacggttccatcgaggccctcaacgaggcctgggga
acggcgttttggtcccagcactacgcatcgtttgacgagatcatcccgccaggcgcagct
cccaccacgctgaaccccgggcagcaactggacttcgcccggttcaattcctgggccttc
atcgattactaccgcgagctgctggccgttatccgcgaagtcaccccgggcatcccggcg
accaccaacttcatggtttccagcgccaccaaggccctggattacttcgattggtccaag
gacatggacgtggttgccaacgaccactacctggtggcggctgaccccgagcgggagatc
gaactggccttcagcgccgatctcacgcgcggcgtggcgggcggcgagccgtggatcctc
atggagcactcgacgtcggcggtcaactggcagccccacaaccagcccaaaatgcccggc
gaaatgcttcgaaactcgctgacgcacgtagcccgcggcgccgacgccgtcatgttcttc
cagtggcgtcaaagcaaggccggctcggagaaattccactcagcgatggttccccacggc
ggccgcgacacccaggtgtggcggaacgtggtggacctcggcgacgcgctgtccaagctg
gagaccgtcaagggatcgagggtggaatcccgtgttgcgatcgtgttcgattacgaggcc
tggtgggcttcggagttggattcgcacccgaacaattcgctgaaatacctggacaccatg
cgggcattccaccgctccctgtataagcgcggaatcaccgcggacttcgtccacccgtcc
tcggatttgtccggttacgacctcatcctggtgtgcactttgtactccgtaacggacgcc
gcggccgcctccattgcggcagccgcggagggtggcgccacagtactgatcagctacttc
agcggcattgttgatgaacgggaccacgttcgattgggcggctaccccggcgctttccgc
gaattattgggcgttcggggtgaggagttccacccacttctccccggcacgtcggtcacg
ttgagcgatgggacggtggggtccgtgtggagcgagcacgtccacgcggccgagggtacg
gagattttggcaacgttcaccgactacccgctcggcgaggtgccggcattgacgcggcgt
tccgtcggaacgggttctgcctggtacctcgccacgcttcccgacgccgatggcatcgac
tccctcaccgcgcgactcgtggaggaagcaggggtgagggccgtgaccgaggtgtctgcc
ggcgtcgaacttacgcgacggcgggccgctgacggccgcacgttcctgttcgccatcaac
cacagccaggaggacgttacggtaaaggccgacggcggcgaactgctcagcggcgcgcgc
tttacgggagtggtacccgccggagccgtggccgtcatcgcggaagactga

DBGET integrated database retrieval system